Property Summary

NCBI Gene PubMed Count 37
Grant Count 27
R01 Count 15
Funding $3,009,280.55
PubMed Score 35.87
PubTator Score 37.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.100 0.000
glioblastoma -2.300 0.000
oligodendroglioma -1.300 0.000
group 4 medulloblastoma -2.600 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -2.000 0.002
primitive neuroectodermal tumor -2.100 0.004
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -1.200 0.002
psoriasis -1.900 0.000

Gene RIF (28)

PMID Text
24431462 An association between rs10748842 genotype in neuregulin 3 does not fit a simple inefficiency model of risk association in dorsolateral prefrontal cortex physiology.
24061483 This study demonstrated that genetic variants in the NRG3 gene play a role in alzheimer disease and revealed that SNPs in the NRG3 genes were more strongly associated with onset age of Alzherimer disease.
23999525 these data suggest that Nrg3/ErbB4 signaling may be an important factor in nicotine dependence.
23315268 NRG3 may be a susceptibility gene for Hirschsprung's disease in a Chinese population.
22981155 no association of SNPs or haplotypes with risk of schizophrenia in Han Chinese population
22831755 Neuregulin 3 rs6584400 genetic carriers are associated with psychotic symptoms and attention performance in schizophrenia.
22589734 Our results suggest a role for NRG3 in HSCR etiology and provide insights into the relative contribution of structural variants in both syndromic and non-syndromic HSCR.
21762460 NRG3 polymorphisms and haplotypes were similar between schizophrenia patients and healthy controls of Korean ethnicity
21705454 Data show that rs1649942, which is located in the intron region of NM_001165973.1. (NRG3 neuregulin 3), was associated with poorer overall survival in women with optimally debulked tumors.
20713722 Data show that NRG3 is a schizophrenia susceptibility gene, provide quantitative insight into NRG3 transcription traits in the brain, and reveal a probable mechanistic basis for disease association.
More...

AA Sequence

MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVWNRQQTWLCVV      1 - 70
PLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSSFPKAMETTTTTTSTTSPATP     71 - 140
SAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPRSTTARNTAAPATVPSTTAPFFSSSTLGSRP    141 - 210
PVPGTPSTQAMPSWPTAAYATSSYLHDSTPSWTLSPFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYS    211 - 280
TERSEHFKPCRDKDLAYCLNDGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEF    281 - 350
MESEEVYQRQVLSISCIIFGIVIVGMFCAAFYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLV    351 - 420
KSHVQLQNYSKVERHPVTALEKMMESSFVGPQSFPEVPSPDRGSQSVKHHRSLSSCCSPGQRSGMLHRNA    421 - 490
FRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGIEVRKTISHLPIQLWCVERPLDLKYSSSGLKT    491 - 560
QRNTSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQMPGISEVKSIKWCKNSYS    561 - 630
ADVVNVSIPVSDCLIAEQQEVKILLETVQEQIRILTDARRSEDYELASVETEDSASENTAFLPLSPTAKS    631 - 700
EREAQFVLRNEIQRDSALTK                                                      701 - 720
//

Text Mined References (38)

PMID Year Title
24431462 2014 Effects of neuregulin 3 genotype on human prefrontal cortex physiology.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
24061483 2014 NRG3 gene is associated with the risk and age at onset of Alzheimer disease.
23999525 2014 Evidence from mouse and man for a role of neuregulin 3 in nicotine dependence.
23393555 2013 Genome-wide association study of retinopathy in individuals without diabetes.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23315268 2013 Exome sequencing identified NRG3 as a novel susceptible gene of Hirschsprung's disease in a Chinese population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22981155 2013 No genetic evidence for Neuregulin 3 conferring risk of schizophrenia in the Chinese population.
22831755 2013 Neuregulin 3 is associated with attention deficits in schizophrenia and bipolar disorder.
More...