Property Summary

NCBI Gene PubMed Count 39
PubMed Score 39.36
PubTator Score 37.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.300 4.9e-04
astrocytoma -1.100 4.0e-09
Astrocytoma, Pilocytic -1.200 2.7e-03
atypical teratoid / rhabdoid tumor -2.600 1.7e-04
glioblastoma -2.200 1.1e-06
group 3 medulloblastoma -2.300 1.9e-03
medulloblastoma, large-cell -2.000 1.6e-03
oligodendroglioma -1.300 8.3e-10
primitive neuroectodermal tumor -2.100 3.5e-03
psoriasis -1.900 5.4e-41

Gene RIF (30)

AA Sequence

MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVWNRQQTWLCVV      1 - 70
PLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSSFPKAMETTTTTTSTTSPATP     71 - 140
SAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPRSTTARNTAAPATVPSTTAPFFSSSTLGSRP    141 - 210
PVPGTPSTQAMPSWPTAAYATSSYLHDSTPSWTLSPFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYS    211 - 280
TERSEHFKPCRDKDLAYCLNDGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEF    281 - 350
MESEEVYQRQVLSISCIIFGIVIVGMFCAAFYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLV    351 - 420
KSHVQLQNYSKVERHPVTALEKMMESSFVGPQSFPEVPSPDRGSQSVKHHRSLSSCCSPGQRSGMLHRNA    421 - 490
FRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGIEVRKTISHLPIQLWCVERPLDLKYSSSGLKT    491 - 560
QRNTSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQMPGISEVKSIKWCKNSYS    561 - 630
ADVVNVSIPVSDCLIAEQQEVKILLETVQEQIRILTDARRSEDYELASVETEDSASENTAFLPLSPTAKS    631 - 700
EREAQFVLRNEIQRDSALTK                                                      701 - 720
//

Text Mined References (40)

PMID Year Title