Property Summary

NCBI Gene PubMed Count 19
PubMed Score 33.09
PubTator Score 16.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Melanoma 711 3.077 1.5
Disease Target Count P-value
osteosarcoma 7950 9.2e-10
ovarian cancer 8520 2.3e-06
diabetes mellitus 1728 1.5e-03
spina bifida 1074 4.1e-02
Disease Target Count Z-score Confidence
Alopecia areata 41 3.799 1.9
Disease Target Count Z-score Confidence
Vici syndrome 14 3.939 2.0
Vitiligo 73 3.716 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.100 1.5e-03
osteosarcoma 2.408 9.2e-10
ovarian cancer -1.300 2.3e-06
spina bifida -1.404 4.1e-02

Gene RIF (10)

AA Sequence

MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIR      1 - 70
EIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGA     71 - 140
FHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSA    141 - 210
AVNVEEGTKNLGKAAKYKLAALPVAGALIGGMVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRKKQ    211 - 280
KMMEKLTSSCPDLPSQTDKKCS                                                    281 - 302
//

Text Mined References (27)

PMID Year Title