Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
R01 Count 1
Funding $53,160.5
PubMed Score 26.15
PubTator Score 16.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 2.408 0.000
diabetes mellitus -1.100 0.001
spina bifida -1.404 0.041
ovarian cancer -1.300 0.000

Synonym

Accession P56962 Q4VXC2
Symbols

Gene

 Grant Application (1)

PDB

4WY4  

Gene RIF (7)

PMID Text
25619926 Syn17 acts as a switch that responds to nutrient conditions and integrates functions for the endoplasmic reticulum and autophagosomes with mitochondrial dynamics
24554770 the homotypic fusion and protein sorting-tethering complex promotes autophagosome-lysosome fusion through interaction with STX17
23217709 Study identifies syntaxin 17 (Stx17) as the autophagosomal SNARE required for fusion with the endosome/lysosome.
21545355 The syntaxin 17 is essential for maintaining the architecture of ERGIC and Golgi.
20596022 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19209086 Common variants in the STX17 gene region do not play a key role in the pathogenesis of human melanoma.
19209086 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIR      1 - 70
EIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGA     71 - 140
FHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSA    141 - 210
AVNVEEGTKNLGKAAKYKLAALPVAGALIGGMVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRKKQ    211 - 280
KMMEKLTSSCPDLPSQTDKKCS                                                    281 - 302
//

Text Mined References (22)

PMID Year Title
25686604 2015 ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
25619926 2015 A role for the ancient SNARE syntaxin 17 in regulating mitochondrial division.
24554770 2014 The HOPS complex mediates autophagosome-lysosome fusion through interaction with syntaxin 17.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23455425 2013 Autophagosomes form at ER-mitochondria contact sites.
23217709 2012 The hairpin-type tail-anchored SNARE syntaxin 17 targets to autophagosomes for fusion with endosomes/lysosomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23006999 2012 Tyrosine phosphorylation of a SNARE protein, syntaxin 17: implications for membrane trafficking in the early secretory pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21545355 2011 Syntaxin 17 cycles between the ER and ERGIC and is required to maintain the architecture of ERGIC and Golgi.
More...