Property Summary

NCBI Gene PubMed Count 14
PubMed Score 26.15
PubTator Score 16.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Melanoma 261
Disease Target Count P-value
osteosarcoma 7933 9.24361524277408E-10
ovarian cancer 8492 2.29323106617524E-6
diabetes mellitus 1663 0.00146300475658371
spina bifida 1064 0.0414053479524123
Disease Target Count Z-score Confidence
Alopecia areata 37 3.426 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 2.408 0.000
diabetes mellitus -1.100 0.001
spina bifida -1.404 0.041
ovarian cancer -1.300 0.000

Synonym

Accession P56962 Q4VXC2
Symbols

Gene

PDB

4WY4  

  Ortholog (12)

 GWAS Trait (1)

Gene RIF (7)

PMID Text
25619926 Syn17 acts as a switch that responds to nutrient conditions and integrates functions for the endoplasmic reticulum and autophagosomes with mitochondrial dynamics
24554770 the homotypic fusion and protein sorting-tethering complex promotes autophagosome-lysosome fusion through interaction with STX17
23217709 Study identifies syntaxin 17 (Stx17) as the autophagosomal SNARE required for fusion with the endosome/lysosome.
21545355 The syntaxin 17 is essential for maintaining the architecture of ERGIC and Golgi.
20596022 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19209086 Common variants in the STX17 gene region do not play a key role in the pathogenesis of human melanoma.
19209086 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIR      1 - 70
EIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGA     71 - 140
FHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSA    141 - 210
AVNVEEGTKNLGKAAKYKLAALPVAGALIGGMVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRKKQ    211 - 280
KMMEKLTSSCPDLPSQTDKKCS                                                    281 - 302
//

Text Mined References (22)

PMID Year Title
25686604 2015 ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
25619926 2015 A role for the ancient SNARE syntaxin 17 in regulating mitochondrial division.
24554770 2014 The HOPS complex mediates autophagosome-lysosome fusion through interaction with syntaxin 17.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23455425 2013 Autophagosomes form at ER-mitochondria contact sites.
23217709 2012 The hairpin-type tail-anchored SNARE syntaxin 17 targets to autophagosomes for fusion with endosomes/lysosomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23006999 2012 Tyrosine phosphorylation of a SNARE protein, syntaxin 17: implications for membrane trafficking in the early secretory pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21545355 2011 Syntaxin 17 cycles between the ER and ERGIC and is required to maintain the architecture of ERGIC and Golgi.
More...