Property Summary

NCBI Gene PubMed Count 152
Grant Count 208
R01 Count 155
Funding $12,121,620.83
PubMed Score 211.22
PubTator Score 431.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.933 0.000

Synonym

Accession P56945 B3KWD7 B4DEV4 B4DGB5 B4DIW5 B7Z7X7 E9PCL5 E9PCV2 F5GXA2 F5GXV6 F5H7Z0 F8WA69 Q6QEF7
Symbols CAS
CAS1
CASS1
CRKAS
P130Cas

Gene

PDB

1WYX   3T6G  

 GWAS Trait (1)

Gene RIF (79)

PMID Text
27068854 blockade of GD3-mediated growth signaling pathways by siRNAs might be a novel and promising therapeutic strategy against malignant melanomas, provided signaling molecules such as p130Cas and paxillin are significantly expressed in individual cases.
26716506 Elevated levels of p130Cas is associated with trastuzumab resistance in breast cancer.
26276885 expression quantitative trait loci studies implicate BCAR1 as the causal gene of coronary artery disease Carotid intima-media thickness
25805500 p130(Cas) exon 1 variants display altered functional properties; shorter 1B isoform exhibited diminished FAK binding activity + reduced cell migration + invasion; longest variant 1B1 exhibited the most efficient FAK binding + greatly enhanced migration
25727852 BCAR1 has a pivotal role in the regulation of tissue homeostasis in pathological conditions such as cancer. (Review)
25253349 Collectively, these studies demonstrate that p130Cas acts as a bridging molecule between the Kaposi's sarcoma-associated herpesvirus-induced entry signal complex and the downstream trafficking signalosome in endothelial cells.
24928898 Cas promotes cell migration by linking actomyosin contractions to the adhesion complexes through interaction with Src and the actin cytoskeleton.
24584939 BCAR1 and BCAR3 scaffolding proteins have roles in cell signaling and antiestrogen resistance
24494199 Data introduce hitherto unappreciated paradigms whereby reactive oxygen species can reciprocally regulate the cellular localization of pro- and anti-migratory signaling molecules, p130cas and PTEN, respectively.
24284072 Our results show that endogenous Cul5 suppresses epithelial cell transformation by several pathways, including inhibition of Src-Cas-induced ruffling through SOCS6
More...

AA Sequence

MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKK      1 - 70
PAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSP     71 - 140
PAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPA    141 - 210
KVVVPTRVGQGYVYEAAQPEQDEYDIPRHLLAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGR    211 - 280
DPLLEVYDVPPSVEKGLPPSNHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAA    281 - 350
PPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREA    351 - 420
PAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSW    421 - 490
RSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQ    491 - 560
ALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTS    561 - 630
SIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQ    631 - 700
LKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVA    701 - 770
TNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSP    771 - 840
SAAQDMVERVKELGHSTQQFRRVLGQLAAA                                            841 - 870
//

Text Mined References (162)

PMID Year Title
27068854 2016 A therapeutic trial of human melanomas with combined small interfering RNAs targeting adaptor molecules p130Cas and paxillin activated under expression of ganglioside GD3.
26716506 2016 p130Cas scaffold protein regulates ErbB2 stability by altering breast cancer cell sensitivity to autophagy.
26276885 2015 Functional Analysis of a Carotid Intima-Media Thickness Locus Implicates BCAR1 and Suggests a Causal Variant.
25805500 2015 Identification of Novel Crk-associated Substrate (p130Cas) Variants with Functionally Distinct Focal Adhesion Kinase Binding Activities.
25727852 2015 p130Cas/BCAR1 scaffold protein in tissue homeostasis and pathogenesis.
25253349 2014 p130Cas scaffolds the signalosome to direct adaptor-effector cross talk during Kaposi's sarcoma-associated herpesvirus trafficking in human microvascular dermal endothelial cells.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24928898 2014 Displacement of p130Cas from focal adhesions links actomyosin contraction to cell migration.
24584939 2014 Association of the breast cancer antiestrogen resistance protein 1 (BCAR1) and BCAR3 scaffolding proteins in cell signaling and antiestrogen resistance.
24494199 2014 Intracellular redox status controls membrane localization of pro- and anti-migratory signaling molecules.
More...