Property Summary

NCBI Gene PubMed Count 30
Grant Count 19
R01 Count 8
Funding $1,787,957.93
PubMed Score 16.47
PubTator Score 370.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.600 0.000
adult high grade glioma 1.100 0.002

Gene RIF (20)

PMID Text
25966904 the dual functional 17beta-HSD7 is proposed as a novel target for estrogen-dependent breast cancer by regulating the balance of estradiol and dihydrotestosterone.
25257817 17beta-HSD1 and 17beta-HSD7 are principal reductive 17beta-hydroxysteroid dehydrogenases and major players in the viability of estrogen-dependent breast cancer cells.
23300627 17betaHSD7 is not the key enzyme responsible for androstenone and testosterone metabolism in porcine liver cells
21372145 estradiol stimulates HSD17B7 transcriptional activity in breast cancer cells through a novel mechanism requiring NF1 and strongly suggest a positive feedback mechanism, increasing estradiol synthesis causing growth of estrogen-dependent breast cancers
21086175 Data show that apicidin significantly lowers HSD17B1 transcript and protein levels in endometrial adenocarcinoma cells, with no significant effect on HSD17B1 transcript stability.
20215536 increased expression of HSD17B7 is associated with breast cancer.
20214802 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
19735314 The transcriptional activity of the HSD17B7 gene containing the G allele is higher than that of the C allele. This difference in HSD17B7 expression may regulate the risk of peripheral edema as an adverse reaction induced by estramustine phosphate sodium
19536175 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRKVVLITGASSGIGLALCKRLLAEDDELHLCLACRNMSKAEAVCAALLASHPTAEVTIVQVDVSNLQSV      1 - 70
FRASKELKQRFQRLDCIYLNAGIMPNPQLNIKALFFGLFSRKVIHMFSTAEGLLTQGDKITADGLQEVFE     71 - 140
TNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFSLEDFQHSKGKEPYSSSKYATDLLSVALNRN    141 - 210
FNQQGLYSNVACPGTALTNLTYGILPPFIWTLLMPAILLLRFFANAFTLTPYNGTEALVWLFHQKPESLN    211 - 280
PLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL             281 - 341
//

Text Mined References (33)

PMID Year Title
25966904 2015 Synergistic control of sex hormones by 17?-HSD type 7: a novel target for estrogen-dependent breast cancer.
25257817 2015 Reductive 17beta-hydroxysteroid dehydrogenases which synthesize estradiol and inactivate dihydrotestosterone constitute major and concerted players in ER+ breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23300627 2012 Investigation of testosterone, androstenone, and estradiol metabolism in HepG2 cells and primary culture pig hepatocytes and their effects on 17?HSD7 gene expression.
21372145 2011 The stimulation of HSD17B7 expression by estradiol provides a powerful feed-forward mechanism for estradiol biosynthesis in breast cancer cells.
21269460 2011 Initial characterization of the human central proteome.
21086175 2011 Apicidin suppresses transcription of 17?-hydroxysteroid dehydrogenase type 1 in endometrial adenocarcinoma cells.
20215536 2010 Intratumoral estrogen disposition in breast cancer.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
More...