Property Summary

Ligand Count 3
NCBI Gene PubMed Count 32
PubMed Score 17.84
PubTator Score 370.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma 1.100 2.0e-03
atypical teratoid / rhabdoid tumor 1.200 1.7e-04
medulloblastoma, large-cell 1.600 1.0e-04

Protein-protein Interaction (4)

Gene RIF (22)

AA Sequence

MRKVVLITGASSGIGLALCKRLLAEDDELHLCLACRNMSKAEAVCAALLASHPTAEVTIVQVDVSNLQSV      1 - 70
FRASKELKQRFQRLDCIYLNAGIMPNPQLNIKALFFGLFSRKVIHMFSTAEGLLTQGDKITADGLQEVFE     71 - 140
TNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFSLEDFQHSKGKEPYSSSKYATDLLSVALNRN    141 - 210
FNQQGLYSNVACPGTALTNLTYGILPPFIWTLLMPAILLLRFFANAFTLTPYNGTEALVWLFHQKPESLN    211 - 280
PLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL             281 - 341
//

Text Mined References (35)

PMID Year Title