Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.33
PubTator Score 19.16

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (13)

AA Sequence

MPASMFSIDNILAARPRCKDSVLPVAHSAAAPVVFPALHGDSLYGASGGASSDYGAFYPRPVAPGGAGLP      1 - 70
AAVSGSRLGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMN     71 - 140
VGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKN    141 - 210
RRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS                           211 - 257
//

Text Mined References (20)

PMID Year Title