Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.50
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
periodontitis 269

Expression

  Differential Expression (1)

Disease log2 FC p
periodontitis -1.300 0.000

AA Sequence

MASAGLQLLAFILALSGVSGVLTATLLPNWKVNVDVDSNIITAIVQLHGLWMDCTWYSTGMFSCALKHSI      1 - 70
LSLPIHVQAARATMVLACVLSALGICTSTVGMKCTRLGGDRETKSHASFAGGVCFMSAGISSLISTVWYT     71 - 140
KEIIANFLDLTVPESNKHEPGGAIYIGFISAMLLFISGMIFCTSCIKRNPEARLDPPTQQPISNTQLENN    141 - 210
STHNLKDYV                                                                 211 - 219
//

Text Mined References (15)

PMID Year Title
19706201 2009 The claudins.
18480174 2008 Biology of claudins.
18036336 2008 Structure and function of claudins.
17679949 2007 Analysis of the RPE transcriptome reveals dynamic changes during the development of the outer blood-retinal barrier.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16836752 2006 The claudin gene family: expression in normal and neoplastic tissues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
More...