Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.50
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
periodontitis 293 2.6e-30

Expression

  Differential Expression (1)

Disease log2 FC p
periodontitis -1.300 2.6e-30

AA Sequence

MASAGLQLLAFILALSGVSGVLTATLLPNWKVNVDVDSNIITAIVQLHGLWMDCTWYSTGMFSCALKHSI      1 - 70
LSLPIHVQAARATMVLACVLSALGICTSTVGMKCTRLGGDRETKSHASFAGGVCFMSAGISSLISTVWYT     71 - 140
KEIIANFLDLTVPESNKHEPGGAIYIGFISAMLLFISGMIFCTSCIKRNPEARLDPPTQQPISNTQLENN    141 - 210
STHNLKDYV                                                                 211 - 219
//

Text Mined References (15)

PMID Year Title