Property Summary

NCBI Gene PubMed Count 33
Grant Count 14
R01 Count 8
Funding $1,160,079.71
PubMed Score 38.74
PubTator Score 39.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (22)

PMID Text
26919807 Data suggest that claudin-18 suppresses the abnormal proliferation and motility of lung epithelial cells mediated by inhibition of phosphorylation of pyruvate dehydrogenase kinase isoform 1 (PDK1) and proto-oncogene protein c-akt (Akt).
24787463 Human fetal lungs at 23-24 weeks gestational age, the highest-risk period for developing bronchopulmonary dysplasia, a disease of impaired alveolarization, had significantly lower CLDN18 expression relative to postnatal lungs.
24710653 High levels of CLDN18 are associated with non-small-cell lung cancer.
24647998 Downregulation of miR-1303 can inhibit proliferation, migration and invasion of gastric cancer cells by targeting CLDN18.
24333468 Evaluated expression of claudins in gastric cancer and determined their significance for patient outcome. Claudin-3 and claudin-7 were expressed in 25.4% and 29.9% of gastric cancer tissues; 51.5% of gastric cancer tissues had reduced claudin-18.
24073219 Down-regulation of claudin-18 is associated with the proliferative and invasive potential of gastric cancer.
23905715 Claudin-18 positivity is a specific phenotype that is characteristic of intestinal-type Mucinous borderline tumours of the ovary
23900716 rate of CLDN18.2 positivity is high in pancreatic neoplasms whereby the expression is not limited to the primaries but is also maintained upon metastasis
23570326 Reduced expression of olfactomedin 4 and ectopic expression of claudin-18 might be useful markers in the differential diagnosis of serrated polyps.
22076167 Claudin 10/18 are most commonly expressed in lung adenocarcinomas. Female patients and non-smokers express these claudins more commonly suggesting that they may play a part in the carcinogenesis of tobacco unrelated carcinoma.
More...

AA Sequence

MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGFTECRPYFTIL      1 - 70
GLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLTSGIMFIVSGLCAIAGVSVFA     71 - 140
NMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYKAVS    141 - 210
YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV                       211 - 261
//

Text Mined References (34)

PMID Year Title
26919807 2016 Claudin-18 inhibits cell proliferation and motility mediated by inhibition of phosphorylation of PDK1 and Akt in human lung adenocarcinoma A549 cells.
24787463 2014 Claudin-18 deficiency results in alveolar barrier dysfunction and impaired alveologenesis in mice.
24710653 2014 Aberrantly activated claudin 6 and 18.2 as potential therapy targets in non-small-cell lung cancer.
24647998 2014 miR-1303 targets claudin-18 gene to modulate proliferation and invasion of gastric cancer cells.
24333468 2014 Expression of claudin-7 and loss of claudin-18 correlate with poor prognosis in gastric cancer.
24073219 2013 Down-regulation of claudin-18 is associated with the proliferative and invasive potential of gastric cancer at the invasive front.
23905715 2013 Claudin-18 overexpression in intestinal-type mucinous borderline tumour of the ovary.
23900716 2014 Claudin 18.2 is a target for IMAB362 antibody in pancreatic neoplasms.
23570326 2013 Expression of olfactomedin 4 and claudin-18 in serrated neoplasia of the colorectum: a characteristic pattern is associated with sessile serrated lesion.
22076167 2011 Claudins 10 and 18 are predominantly expressed in lung adenocarcinomas and in tumors of nonsmokers.
More...