Property Summary

NCBI Gene PubMed Count 36
PubMed Score 43.72
PubTator Score 39.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Protein-protein Interaction (2)

Gene RIF (25)

AA Sequence

MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGFTECRPYFTIL      1 - 70
GLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLTSGIMFIVSGLCAIAGVSVFA     71 - 140
NMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYKAVS    141 - 210
YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV                       211 - 261
//

Text Mined References (37)

PMID Year Title