Property Summary

NCBI Gene PubMed Count 9
PubMed Score 12.37
PubTator Score 22.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Azoospermia 110 4.428 2.2

AA Sequence

MASSLKIWGTLLALLCILCTLLVQSKEVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIY      1 - 70
ISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLK     71 - 140
MVEPIGN                                                                   141 - 147
//

Text Mined References (10)

PMID Year Title