Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
R01 Count 4
Funding $317,634.25
PubMed Score 12.37
PubTator Score 22.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Azoospermia 89 4.423 2.2

AA Sequence

MASSLKIWGTLLALLCILCTLLVQSKEVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIY      1 - 70
ISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLK     71 - 140
MVEPIGN                                                                   141 - 147
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11715855 2001 Human epididymal proteins and sperm function during fertilization: un update.
9739419 Function of human epididymal proteins in sperm maturation.
9685187 1998 Molecular characterization of epididymal proteins.
7514008 1994 Major human epididymis-specific gene product, HE3, is the first representative of a novel gene family.