Property Summary

Ligand Count 3,691
NCBI Gene PubMed Count 331
PubMed Score 2003.34
PubTator Score 1007.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

 CSPA Cell Line (1)

PDB (360)

Gene RIF (307)

AA Sequence

MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGK      1 - 70
SGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGE     71 - 140
LGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNL    141 - 210
FSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKE    211 - 280
YNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMG    281 - 350
EVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC    351 - 420
HVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQH    421 - 490
DDFADDISLLK                                                               491 - 501
//

Text Mined References (334)

PMID Year Title