Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.54
PubTator Score 2.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 6.6e-07
psoriasis 6694 2.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Gene RIF (3)

AA Sequence

MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSL      1 - 70
LALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWT     71 - 140
ANIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQGYRYPVPGYRVPHTDKR    141 - 210
RNTTMLSKTSTSYV                                                            211 - 224
//

Text Mined References (19)

PMID Year Title