Property Summary

NCBI Gene PubMed Count 28
PubMed Score 8.71
PubTator Score 3.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (5)

AA Sequence

MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYDGSSDCLMY      1 - 70
DTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLF     71 - 140
FLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPL    141 - 210
YSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT                                        211 - 244
//

Text Mined References (31)

PMID Year Title