Property Summary

NCBI Gene PubMed Count 26
Grant Count 2
Funding $50,303.8
PubMed Score 8.02
PubTator Score 3.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25727011 Knockdown of claudin-3, claudin-4, and claudin-12, but not claudin-1, increased breast cancer MCF-7 cell migration with maximal effects observed in claudin-12 siRNA-transfected cells.
23898208 HIV-1 Tat downregulates the expression of claudin 12 (CLDN12) in human primary T cells
18287530 These findings strongly suggest that claudin-2- and/or claudin-12-based tight junctions form paracellular Ca(2+) channels in intestinal epithelia, and they highlight a novel mechanism behind vitamin D-dependent calcium homeostasis.
17047970 Differential expression of genes encoding claudins in colorectal cancer suggests that these tight junction proteins may be associated to and involved in tumorigenesis.

AA Sequence

MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYDGSSDCLMY      1 - 70
DTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLF     71 - 140
FLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPL    141 - 210
YSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT                                        211 - 244
//

Text Mined References (29)

PMID Year Title
25727011 2015 Interleukin-18 enhances breast cancer cell migration via down-regulation of claudin-12 and induction of the p38 MAPK pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19924644 2010 Claudins in human cancer: a review.
19706201 2009 The claudins.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18287530 2008 Tight junction proteins claudin-2 and -12 are critical for vitamin D-dependent Ca2+ absorption between enterocytes.
18036336 2008 Structure and function of claudins.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17047970 2007 Differential expression of genes encoding tight junction proteins in colorectal cancer: frequent dysregulation of claudin-1, -8 and -12.
More...