Property Summary

NCBI Gene PubMed Count 29
Grant Count 5
R01 Count 4
Funding $1,065,866.78
PubMed Score 24.61
PubTator Score 18.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
urothelial carcinoma -1.300 0.026
psoriasis -3.000 0.000
ulcerative colitis -4.600 0.000
colon cancer -5.600 0.000
active Crohn's disease -2.762 0.029
cystic fibrosis -3.200 0.000
Breast cancer -4.400 0.000
breast carcinoma -2.300 0.000

Gene RIF (8)

PMID Text
26560196 High Claudin 8 Contributes to Malignant Proliferation in Osteosarcoma.
26464708 the expression of claudin-5 and claudin-9 was down-regulated while the expression of claudin-8 was up-regulated in cervical carcinoma tissues compared with adjacent non-neoplastic tissues.
23322640 Human Cldn-8 and -14 were shown to convey Clostridium perfringens enterotoxin-mediated cytotoxicity at pathophysiologically relevant concentrations of this toxin, although ~2-to-10-fold less efficiently than Cldn-4.
19302533 the combination of CK7, S100A1 and claudin 8 immunohistochemistry can be useful for classifying tumours of overlapping histology as chromophobe renal cell carcinoma or renal oncocytomas.
19000657 Na(+) absorption is paralleled by claudin-8-mediated sealing of the paracellular barrier to prevent Na(+) back-leakage, supporting steep Na(+) gradients in distal colon.
18799195 claudin-7 and claudin-8 have potential use as immunohistochemical biomarkers in the differential diagnosis of chromophobe renal cell carcinoma and oncocytoma
17047970 Differential expression of genes encoding claudins in colorectal cancer suggests that these tight junction proteins may be associated to and involved in tumorigenesis.
12736707 CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

AA Sequence

MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSL      1 - 70
LALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILLTAGIIFIITGMVVLIPVSWV     71 - 140
ANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYH    141 - 210
TGKKSPSVYSRSQYV                                                           211 - 225
//

Text Mined References (31)

PMID Year Title
26560196 2015 Claudin 8 Contributes to Malignant Proliferation in Human Osteosarcoma U2OS Cells.
26464708 2015 Expression of claudin-5, -7, -8 and -9 in cervical carcinoma tissues and adjacent non-neoplastic tissues.
25416956 2014 A proteome-scale map of the human interactome network.
23322640 2013 Human claudin-8 and -14 are receptors capable of conveying the cytotoxic effects of Clostridium perfringens enterotoxin.
22042635 2012 Antibody-based protein profiling of the human chromosome 21.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
19924644 2010 Claudins in human cancer: a review.
19706201 2009 The claudins.
19302533 2009 Immunohistochemical stain for cytokeratin 7, S100A1 and claudin 8 is valuable in differential diagnosis of chromophobe renal cell carcinoma from renal oncocytoma.
19000657 2009 Na+ absorption defends from paracellular back-leakage by claudin-8 upregulation.
More...