Property Summary

NCBI Gene PubMed Count 33
PubMed Score 29.74
PubTator Score 18.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease -2.762 2.9e-02
active ulcerative colitis -3.047 2.2e-02
Breast cancer -4.400 2.0e-16
breast carcinoma -2.300 8.1e-24
colon cancer -5.600 1.5e-14
cystic fibrosis -2.100 9.4e-05
psoriasis -3.000 9.2e-15
urothelial carcinoma -1.300 2.6e-02

Gene RIF (12)

AA Sequence

MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSL      1 - 70
LALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILLTAGIIFIITGMVVLIPVSWV     71 - 140
ANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYH    141 - 210
TGKKSPSVYSRSQYV                                                           211 - 225
//

Text Mined References (35)

PMID Year Title