Property Summary

NCBI Gene PubMed Count 51
PubMed Score 65.99
PubTator Score 39.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 3.2e-04
ovarian cancer 8520 2.2e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.028 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.500 3.2e-04
ovarian cancer 1.600 2.2e-03

Gene RIF (26)

AA Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSL      1 - 70
LALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTA     71 - 140
HAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRG    141 - 210
PSEYPTKNYV                                                                211 - 220
//

Text Mined References (53)

PMID Year Title