Property Summary

NCBI Gene PubMed Count 47
Grant Count 1
Funding $225,541.75
PubMed Score 60.06
PubTator Score 39.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.500 0.000
ovarian cancer 1.600 0.002

Synonym

Accession P56747 B3KQP9 D3DUA5
Symbols

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (23)

PMID Text
26561856 Data show that claudin-6 (CLDN6) R209Q and occludin (OCLN) P24A mutations do not affect HCV pseudoparticles (HCVpp) entry.
26191261 The expression of ASK1 is correlated with the level of claudin-6 in cervical carcinoma cells and tissues.
24710653 High levels of CLDN6 are associated with non-small-cell lung cancer.
23919729 The expression of claudin-6 was down regulated in gastric cancer tissue.
23864633 Although claudin-6 and claudin-9 can serve as entry factors in cell lines, hepatitis C virus infection into human hepatocytes is not dependent on claudin-6 and claudin-9.
23778593 This work provides a proof of concept for the use of Claudin-6 to eliminate residual undifferentiated human pluripotent stem cells from culture.
23775920 Only some hepatitis C virus strains efficiently use CLDN6 for infection.
22925655 ASK1 signal may play a positive role in the inhibitory effect of claudin-6 in breast cancer.
22455563 Our results show that claudin-6 protein is significantly down-regulated in breast invasive ductal carcinomas
21989342 CLDN6 is not a specific biomarker for atypical teratoid rhabdoid tumors as it is expressed in a variety of other pediatric CNS and soft tissue tumors.
More...

AA Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSL      1 - 70
LALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTA     71 - 140
HAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRG    141 - 210
PSEYPTKNYV                                                                211 - 220
//

Text Mined References (49)

PMID Year Title
26561856 2015 Claudin-6 and Occludin Natural Variants Found in a Patient Highly Exposed but Not Infected with Hepatitis C Virus (HCV) Do Not Confer HCV Resistance In Vitro.
26191261 2015 Expression of apoptosis signal-regulating kinase 1 is associated with tight junction protein claudin-6 in cervical carcinoma.
24710653 2014 Aberrantly activated claudin 6 and 18.2 as potential therapy targets in non-small-cell lung cancer.
23919729 2013 The distinct expression patterns of claudin-2, -6, and -11 between human gastric neoplasms and adjacent non-neoplastic tissues.
23864633 2013 Functional analysis of claudin-6 and claudin-9 as entry factors for hepatitis C virus infection of human hepatocytes by using monoclonal antibodies.
23778593 2013 Immunologic and chemical targeting of the tight-junction protein Claudin-6 eliminates tumorigenic human pluripotent stem cells.
23775920 2014 Isolate-dependent use of claudins for cell entry by hepatitis C virus.
22925655 2012 Apoptosis signal-regulating kinase 1 is associated with the effect of claudin-6 in breast cancer.
22455563 2012 The expression patterns and correlations of claudin-6, methy-CpG binding protein 2, DNA methyltransferase 1, histone deacetylase 1, acetyl-histone H3 and acetyl-histone H4 and their clinicopathological significance in breast invasive ductal carcinomas.
21989342 2012 Claudin-6 is a nonspecific marker for malignant rhabdoid and other pediatric tumors.
More...