Property Summary

NCBI Gene PubMed Count 18
Grant Count 2
Funding $416,103.67
PubMed Score 14.81
PubTator Score 7.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.300 0.000
medulloblastoma 1.100 0.003
active Crohn's disease -1.746 0.004
ovarian cancer -4.100 0.000

Synonym

Accession P56746 B3KPB5
Symbols

Gene

PANTHER Protein Class (2)

 Grant Application (2)

AA Sequence

MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLA      1 - 70
LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATAGALHILAGICGMVAISWYAF     71 - 140
NITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLCSACCCGSDEDPAASARRPYQAPVSVMPVAT    141 - 210
SDQEGDSSFGKYGRNAYV                                                        211 - 228
//

Text Mined References (19)

PMID Year Title
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
19706201 2009 The claudins.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19673046 2009 Ion transport and barrier function in a telomerase-immortalized human nondysplastic, Barrett's cell line (BAR-T).
19420749 2009 Effect of claudin expression on paracellular permeability, migration and invasion of colonic cancer cells.
18036336 2008 Structure and function of claudins.
16798613 Claudins--key pieces in the tight junction puzzle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
13129853 2003 Reversal of charge selectivity in cation or anion-selective epithelial lines by expression of different claudins.
More...