Property Summary

NCBI Gene PubMed Count 20
PubMed Score 19.30
PubTator Score 7.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.7e-29
psoriasis 6694 3.7e-04
active Crohn's disease 922 2.0e-02
group 3 medulloblastoma 4104 2.1e-02
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 1.4
Disease Target Count Z-score Confidence
Pellagra 26 4.237 2.1
Malignant pleural mesothelioma 3 3.312 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -1.311 2.0e-02
group 3 medulloblastoma 1.100 2.1e-02
ovarian cancer -4.100 3.7e-29
psoriasis 1.300 3.7e-04

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLA      1 - 70
LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATAGALHILAGICGMVAISWYAF     71 - 140
NITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLCSACCCGSDEDPAASARRPYQAPVSVMPVAT    141 - 210
SDQEGDSSFGKYGRNAYV                                                        211 - 228
//

Text Mined References (21)

PMID Year Title