Property Summary

NCBI Gene PubMed Count 27
Grant Count 51
R01 Count 35
Funding $4,986,026.81
PubMed Score 49.72
PubTator Score 28.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.437 0.000
medulloblastoma, large-cell -1.100 0.000
interstitial cystitis -1.300 0.000
non primary Sjogren syndrome sicca 1.100 0.017
psoriasis -1.700 0.000

 GO Function (1)

Gene RIF (11)

PMID Text
26548512 the present study detected abnormal upregulation in the levels of Wnt2b and Wnt7b, and hypothesized that the alterations may be due to the ectopic opening of chromatin structure.
26538547 Forced overexpression of Wnt7B with or without TGFB1 treatment increased Wnt5A protein expression in normal human smooth muscle cells and fibroblasts but not in Idiopathic Pulmonary Fibrosis myofibroblasts where Wnt5A was already highly expressed.
25823570 WNT7B as a novel susceptibility gene for axial length and corneal curvature and is associated with myopia and extreme myopia.
24638982 Results illustrated the critical role of myeloid WNT7B in tumor progression, acting at the levels of angiogenesis, invasion, and metastasis.
23416978 WNT7B can serve as a primary determinant of differential Wnt/beta-catenin activation in pancreatic adenocarcinoma.
23386686 Results suggest that AR-regulated WNT7B signaling is critical for the growth of CRPC and development of the osteoblastic bone response characteristic of advanced prostate cancer.
22949635 Pdgf signaling potentiates Wnt2-Wnt7b signaling to promote high levels of Wnt activity in mesenchymal progenitors that is required for proper development of endoderm-derived organs, such as the lung
22838404 Wnt7B was expressed at high concentrations in regions of active hyperplasia, metaplasia, and fibrotic change in idiopathic pulmonary fibrosis patients.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19863181 Results demonstrated significant up-regulation of WNT-3, WNT-4, WNT-5B, WNT-7B, WNT-9A, WNT-10A, and WNT-16B in patients with CLL compared to normal subjects.
More...

AA Sequence

MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGI      1 - 70
NECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGY     71 - 140
YNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCT    141 - 210
TKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEE    211 - 280
DAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK     281 - 349
//

Text Mined References (28)

PMID Year Title
26548512 2016 Abnormal epigenetic regulation of the gene expression levels of Wnt2b and Wnt7b: Implications for neural tube defects.
26538547 2016 Expression of WNT5A in Idiopathic Pulmonary Fibrosis and Its Control by TGF-? and WNT7B in Human Lung Fibroblasts.
25823570 2015 Identification of myopia-associated WNT7B polymorphisms provides insights into the mechanism underlying the development of myopia.
24638982 2014 Myeloid WNT7b mediates the angiogenic switch and metastasis in breast cancer.
23416978 2014 WNT7B mediates autocrine Wnt/?-catenin signaling and anchorage-independent growth in pancreatic adenocarcinoma.
23386686 2013 Role of WNT7B-induced noncanonical pathway in advanced prostate cancer.
22949635 2012 Wnt ligands signal in a cooperative manner to promote foregut organogenesis.
22838404 2012 WNT7B in fibroblastic foci of idiopathic pulmonary fibrosis.
21732829 2011 Wnt signaling and Dupuytren's disease.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
More...