Property Summary

NCBI Gene PubMed Count 28
PubMed Score 52.18
PubTator Score 28.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Congenital diaphragmatic hernia 67 3.044 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis -1.200 1.5e-03
medulloblastoma, large-cell -1.100 4.8e-04
non primary Sjogren syndrome sicca 1.100 1.7e-02
osteosarcoma 1.437 7.2e-05
psoriasis -1.700 1.4e-57

Gene RIF (11)

AA Sequence

MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGI      1 - 70
NECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGY     71 - 140
YNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCT    141 - 210
TKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEE    211 - 280
DAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK     281 - 349
//

Text Mined References (29)

PMID Year Title