Property Summary

NCBI Gene PubMed Count 80
Grant Count 85
R01 Count 57
Funding $7,559,930.86
PubMed Score 213.43
PubTator Score 124.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Barrett's esophagus -1.100 0.050
esophageal adenocarcinoma -1.600 0.026
cutaneous lupus erythematosus -1.200 0.033
psoriasis 1.700 0.001
fibroadenoma 1.900 0.014
cystic fibrosis 1.100 0.000
inflammatory breast cancer -1.600 0.025
lung carcinoma 3.300 0.000
ovarian cancer -1.800 0.000

Synonym

Accession P56705 B4DJF9 Q5TZQ0 Q96T81 Q9BXF5 Q9H1J8 Q9UJM2
Symbols WNT-4
SERKAL

Gene

PANTHER Protein Class (1)

Gene RIF (50)

PMID Text
26848991 Studied the roles of WNT4 and WNT5A in human decidulization and their relationship with preeclampsia.
26139156 Polymorphisms on WNT4 gene might be involved in the pathogenesis of endometriosis in the infertile women.
25901368 the expression of WNT4, a Wnt ligand, and three targets of Wnt-ss-catenin transcription activation, namely, MMP7, cyclinD1 (CD1) and c-MYC in 141 penile tissue cores from 101 unique samples, were investigated.
25682310 The results demonstrated that WNT4 rs2235529 is associated with endometriosis in Chinese Han women, which may result in aberrant expression of WNT4, leading to the pathogenesis of endometriosis.
25337242 Wnt4 might be a key gene during parathyroid hormone-induced epithelial mesenchymal transformation of proximal kidney tubule cells.
25270402 The 5'-flanking region of the Wnt4 gene is responsive to Pax8. Pax8 modulates the expression of Wnt4 in thyroid cells.
25154675 Our results suggest that the rs10965235 SNP in the CDKN2B-AS gene and the rs16826658 SNP near the WNT4 gene were significantly associated with endometriosis in this Korean population.
24356390 We report an adolescent girl with the cardinal features of MURCS association, obesity, and clinical findings of hyperandrogenism who did not show any exonic mutation of the WNT4 gene
24274766 The WNT4 ligand plays a role in regulating the cell growth of leukemia-derived cells by arresting cells in the G1 cell cycle phase.
24200887 These data indicate that Wnt4 signaling is deregulated in most pituitary adenomas and its excessive activation may inhibit pituitary tumor invasion.
More...

AA Sequence

MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRG      1 - 70
AQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDR     71 - 140
TVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHG    141 - 210
VSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFC    211 - 280
EQDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTC    281 - 350
R//

Text Mined References (80)

PMID Year Title
26848991 2016 Dysfunction of WNT4/WNT5A in deciduas: possible relevance to the pathogenesis of preeclampsia.
26139156 2015 Association of WNT4 polymorphisms with endometriosis in infertile patients.
25901368 2015 Targets of Wnt/ß-catenin transcription in penile carcinoma.
25682310 2015 Analysis of WNT4 polymorphism in Chinese Han women with endometriosis.
25337242 2014 Parathyroid hormone induces epithelial-to-mesenchymal transition via the Wnt/?-catenin signaling pathway in human renal proximal tubular cells.
25270402 2014 Pax8 modulates the expression of Wnt4 that is necessary for the maintenance of the epithelial phenotype of thyroid cells.
25154675 2014 Association of CDKN2B-AS and WNT4 genetic polymorphisms in Korean patients with endometriosis.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24356390 2014 Absence of WNT4 gene mutation in a patient with MURCS association.
24274766 2013 Restoration of WNT4 inhibits cell growth in leukemia-derived cell lines.
More...