Property Summary

NCBI Gene PubMed Count 141
Grant Count 180
R01 Count 108
Funding $16,286,388.82
PubMed Score 428.84
PubTator Score 287.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.500 0.000

Synonym

Accession P56704 Q3SY79 Q3SY80 Q969P2
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (111)

PMID Text
27138857 The pool of ADP-ribosylated Axin, which is degraded under basal conditions, increases immediately following Wnt stimulation in both Drosophila and human cells.
26643293 The results reveal a novel inhibitory role of Wnt3a on canonical Wnt/beta-catenin signaling and cancer cell proliferation when there is an insufficient blood supply during tumor development.
26266404 Upregulated Wnt3a in colon cancer cells promoted the capacity to form tube-like structures in the three-dimensional (3-D) culture together with increased expression of endothelial phenotype-associated proteins such as VEGFR2 and VE-cadherin.
25848952 72 Wnt target genes higher expressed in triple-negative breast cancer
25805505 Wnt3a can modulate intracellular localisation and secretion of sFRP4.
25656539 Wnt-mediated protein stabilization ensures proper mitotic microtubule assembly and chromosome segregation.
25651906 These observations demonstrated the first time that Wnt3a can directly activate MyoD expression through targeting cis-elements in the DE and the L fragment.
25572698 Wnt3a and Notch3 may promote the metastasis of non-small cell lung cancer and Notch3 upregulation is required for the Wnt3a mediated increased metastatic abilities of non-small cell lung cancer.
25556760 a Wnt-amplified environment was associated with superior pulp healing.
25499541 Wnt3a expression was associated with epithelial mesenchymal transition and promoted colon cancer progression.
More...

AA Sequence

MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGI      1 - 70
KIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSS     71 - 140
RHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSG    141 - 210
SCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNF    211 - 280
CEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT    281 - 350
CK                                                                        351 - 352
//

Text Mined References (147)

PMID Year Title
27138857 2016 Wnt pathway activation by ADP-ribosylation.
26687115 2016 The microRNA-29 family in cartilage homeostasis and osteoarthritis.
26643293 2016 Wnt3a suppresses Wnt/?-catenin signaling and cancer cell proliferation following serum deprivation.
26266404 2015 Wnt3a Promotes the Vasculogenic Mimicry Formation of Colon Cancer via Wnt/?-Catenin Signaling.
25848952 2015 Transcriptome analysis of Wnt3a-treated triple-negative breast cancer cells.
25805505 2015 Number and brightness analysis of sFRP4 domains in live cells demonstrates vesicle association signal of the NLD domain and dynamic intracellular responses to Wnt3a.
25731175 2015 Notum deacylates Wnt proteins to suppress signalling activity.
25656539 2015 Wnt-mediated protein stabilization ensures proper mitotic microtubule assembly and chromosome segregation.
25651906 2015 Wnt3a signal pathways activate MyoD expression by targeting cis-elements inside and outside its distal enhancer.
25572698 2015 Wnt3a increases the metastatic potential of non-small cell lung cancer cells in vitro in part via its upregulation of Notch3.
More...