Property Summary

NCBI Gene PubMed Count 54
Grant Count 44
R01 Count 30
Funding $6,051,289.14
PubMed Score 92.96
PubTator Score 78.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (36)

PMID Text
26505415 Two SNPs (rs3809857 and rs9890413) in the WNT3 gene were subjected to case-control and case-parent analysis
26108805 WNT3 and membrane-associated beta-catenin regulate trophectoderm lineage differentiation in human blastocysts.
26105184 WNT3 involvement in human bladder exstrophy and cloaca development in zebrafish
24852367 Genome association study shows a highly conserved 32 kb intergenic region containing regulatory elements between WNT3 and WNT9B in patients with classic bladder exstrophy.
24647585 Data show that the WNT/beta-CATENIN signaling cascade components, including WNT ligands WNT3 and WNT5A, is crucial for early odontogenesis.
24344732 WNT3 and WNT5B are critical factors, secreted from mesenchymal cancer cells, for instigating the epithelial cancer cell invasion.
24303070 WNT3 inhibits cerebellar granule neuron progenitor proliferation and medulloblastoma formation via MAPK activation.
24162018 Colorectal tumors express elevated levels of Wnt3 and GPR177.
24052941 mRNA level of WNT3 in hESCs correlates with their definitive ectoderm differentiation efficiency.
23071104 Knockdown of Wnt3 by siRNA restored cytoplasmic expression of beta-catenin.
More...

AA Sequence

MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVA      1 - 70
EGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICG     71 - 140
CDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHG    141 - 210
LSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENS    211 - 280
PNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYD    281 - 350
VHTCK                                                                     351 - 355
//

Text Mined References (53)

PMID Year Title
26505415 2015 Variations in WNT3 gene are associated with incidence of non-syndromic cleft lip with or without cleft palate in a northeast Chinese population.
26108805 2015 WNT3 and membrane-associated ?-catenin regulate trophectoderm lineage differentiation in human blastocysts.
26105184 2015 WNT3 involvement in human bladder exstrophy and cloaca development in zebrafish.
25640183 2015 Functional consequences of 17q21.31/WNT3-WNT9B amplification in hPSCs with respect to neural differentiation.
24852367 2014 Genome-wide association study and mouse expression data identify a highly conserved 32 kb intergenic region between WNT3 and WNT9b as possible susceptibility locus for isolated classic exstrophy of the bladder.
24647585 2014 Expression patterns of WNT/?-CATENIN signaling molecules during human tooth development.
24511991 2014 Identification of a novel Parkinson's disease locus via stratified genome-wide association study.
24344732 2014 Mesenchymal-transitioned cancer cells instigate the invasion of epithelial cancer cells through secretion of WNT3 and WNT5B.
24303070 2013 WNT3 inhibits cerebellar granule neuron progenitor proliferation and medulloblastoma formation via MAPK activation.
24162018 2013 Wnt secretion is required to maintain high levels of Wnt activity in colon cancer cells.
More...