Property Summary

NCBI Gene PubMed Count 54
PubMed Score 92.96
PubTator Score 78.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
chronic lymphosyte leukemia 1.700 1.1e-03
group 3 medulloblastoma 1.300 2.1e-03
posterior fossa group B ependymoma 1.300 6.7e-06
lung adenocarcinoma 1.200 1.9e-06
facioscapulohumeral dystrophy 1.300 4.4e-02

Protein-protein Interaction (9)

Gene RIF (36)

PMID Text
26505415 Two SNPs (rs3809857 and rs9890413) in the WNT3 gene were subjected to case-control and case-parent analysis
26108805 WNT3 and membrane-associated beta-catenin regulate trophectoderm lineage differentiation in human blastocysts.
26105184 WNT3 involvement in human bladder exstrophy and cloaca development in zebrafish
24852367 Genome association study shows a highly conserved 32 kb intergenic region containing regulatory elements between WNT3 and WNT9B in patients with classic bladder exstrophy.
24647585 Data show that the WNT/beta-CATENIN signaling cascade components, including WNT ligands WNT3 and WNT5A, is crucial for early odontogenesis.
24344732 WNT3 and WNT5B are critical factors, secreted from mesenchymal cancer cells, for instigating the epithelial cancer cell invasion.
24303070 WNT3 inhibits cerebellar granule neuron progenitor proliferation and medulloblastoma formation via MAPK activation.
24162018 Colorectal tumors express elevated levels of Wnt3 and GPR177.
24052941 mRNA level of WNT3 in hESCs correlates with their definitive ectoderm differentiation efficiency.
23071104 Knockdown of Wnt3 by siRNA restored cytoplasmic expression of beta-catenin.
22288914 study confirmed the involvement of polymorphisms in the WNT3 gene in NCL/P aetiology in the tested population.
22112025 The findings of a significant association between lip and/or palate clefts and two markers in the WNT3 and COL11A2 genes were the most consistent and were observed in all groups analysed and stratified.
22070884 The apoptotic index was significantly lower in high-Wnt3 tumors than in low-Wnt3 tumors (P=0.0245).
21789800 SNP rs415430 in the WNT3 gene was not associated with the risk of development of Parkinson disease
21314951 Extracellular domain of FZD7 (sFZD7) was tested for its functional activity to interact with Wnt3, its ability to inhibit Wnt3-mediated signaling.
20890934 Individuals carrying variant alleles in WNT3 presented an increased risk for cleft lip/palate (p = 0.0003; OR, 1.61; 95% CI, 1.29-2.02) in the Brazilian population studied.
20890934 Observational study of gene-disease association. (HuGE Navigator)
20709709 Abnormalities of the Wnt3/3a pathway (located in the apical ectodermal ridge) include tetra-amelia and loss of the distal phalanges/nails.
20672350 Observational study of gene-disease association. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19863181 Results demonstrated significant up-regulation of WNT-3, WNT-4, WNT-5B, WNT-7B, WNT-9A, WNT-10A, and WNT-16B in patients with CLL compared to normal subjects.
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
19421142 RNA samples from 21 neuroblastoma showed a highly significant FZD1 and/or MDR1 overexpression after treatment, underlining a role for FZD1-mediated Wnt/beta-catenin pathway in clinical chemoresistance.
19365403 WNT activity regulates the self-renewal of prostate cancer cells with stem cell characteristics independently of androgen receptor activity.
18787224 mantle cell lymphoma highly and consistently expressed Wnt3 and Wnt10.
18606139 WNT3 regulates distinct internalization pathways of LRP6 to tune the activation of beta catenin signaling.
18563180 CTLA-4 is a direct target of Wnt/beta-catenin signaling and is expressed in human melanoma tumors
18413325 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18313787 a functional interaction between Wnt3 and FZD7 leading to activation of the Wnt/beta-catenin signaling pathway in HCC cells and may play a role during hepatocarcinogenesis.
18309246 The results indicated that HBx induction in the CCL13-HBx stable cell line downregulated Wnt-3/beta-catenin expression and suppressed cell growth by repressing cell proliferation or triggering cell apoptosis.
18044981 an internally truncated LRP5 receptor is strongly implicated in deregulated activation of the WNT/beta-catenin signaling pathway in hyperparathyroid tumors
16890161 The Wnt-3a triggers the interaction of LRP6 with caveolin and promotes recruitment of Axin to LRP6 phosphorylated by glycogen synthase kinase-3beta and that caveolin thereby inhibits the binding of beta-catenin to Axin.
15588944 Wnt3 plays an important role in regulating characteristics and activity of stromal cells.
15293277 Observational study of gene-disease association. (HuGE Navigator)
11788904 Regulation of WNT3 and WNT3A mRNAs in human cancer cell lines NT2, MCF-7, and MKN45

AA Sequence

MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVA      1 - 70
EGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICG     71 - 140
CDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHG    141 - 210
LSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENS    211 - 280
PNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYD    281 - 350
VHTCK                                                                     351 - 355
//

Text Mined References (53)

PMID Year Title
26505415 2015 Variations in WNT3 gene are associated with incidence of non-syndromic cleft lip with or without cleft palate in a northeast Chinese population.
26108805 2015 WNT3 and membrane-associated ?-catenin regulate trophectoderm lineage differentiation in human blastocysts.
26105184 2015 WNT3 involvement in human bladder exstrophy and cloaca development in zebrafish.
25640183 2015 Functional consequences of 17q21.31/WNT3-WNT9B amplification in hPSCs with respect to neural differentiation.
24852367 2014 Genome-wide association study and mouse expression data identify a highly conserved 32 kb intergenic region between WNT3 and WNT9b as possible susceptibility locus for isolated classic exstrophy of the bladder.
24647585 2014 Expression patterns of WNT/?-CATENIN signaling molecules during human tooth development.
24511991 2014 Identification of a novel Parkinson's disease locus via stratified genome-wide association study.
24344732 2014 Mesenchymal-transitioned cancer cells instigate the invasion of epithelial cancer cells through secretion of WNT3 and WNT5B.
24303070 2013 WNT3 inhibits cerebellar granule neuron progenitor proliferation and medulloblastoma formation via MAPK activation.
24162018 2013 Wnt secretion is required to maintain high levels of Wnt activity in colon cancer cells.
24115276 2014 The regulation and deregulation of Wnt signaling by PARK genes in health and disease.
24052941 2013 WNT3 is a biomarker capable of predicting the definitive endoderm differentiation potential of hESCs.
23071104 2012 Expression of Wnt3 activates Wnt/?-catenin pathway and promotes EMT-like phenotype in trastuzumab-resistant HER2-overexpressing breast cancer cells.
22451204 2012 Meta-analysis of Parkinson's disease: identification of a novel locus, RIT2.
22288914 2012 Genotype and haplotype analysis of WNT genes in non-syndromic cleft lip with or without cleft palate.
22112025 2011 Association studies of candidate genes and cleft lip and palate taking into consideration geographical origin.
22070884 2012 Wnt3 gene expression promotes tumor progression in non-small cell lung cancer.
21812969 2011 Genome-wide association study identifies candidate genes for Parkinson's disease in an Ashkenazi Jewish population.
21789800 2011 [Analysis of single nucleotide polymorphism rs415430 in the WNT3 gene in the Russian population with the Parkinson disease].
21314951 2011 Soluble Frizzled-7 receptor inhibits Wnt signaling and sensitizes hepatocellular carcinoma cells towards doxorubicin.
20890934 2010 Studies with Wnt genes and nonsyndromic cleft lip and palate.
20709709 2011 WNT pathways and upper limb anomalies.
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20039315 2010 Wnt3-frizzled 1 chimera as a model to study canonical Wnt signaling.
19863181 2009 Variation in WNT genes expression in different subtypes of chronic lymphocytic leukemia.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
19421142 2009 The Wnt receptor FZD1 mediates chemoresistance in neuroblastoma through activation of the Wnt/beta-catenin pathway.
19365403 2009 WNT signaling regulates self-renewal and differentiation of prostate cancer cells with stem cell characteristics.
18787224 2008 Constitutive activation of the Wnt canonical pathway in mantle cell lymphoma.
18606139 2008 Wnt3a and Dkk1 regulate distinct internalization pathways of LRP6 to tune the activation of beta-catenin signaling.
18563180 2008 CTLA-4 is a direct target of Wnt/beta-catenin signaling and is expressed in human melanoma tumors.
18413325 2008 Variation in WNT genes is associated with non-syndromic cleft lip with or without cleft palate.
18313787 2008 Functional interaction between Wnt3 and Frizzled-7 leads to activation of the Wnt/beta-catenin signaling pathway in hepatocellular carcinoma cells.
18309246 2008 Effects of hepatitis B virus X protein (HBx) on cell-growth inhibition in a CCL13-HBx stable cell line.
18044981 2007 An LRP5 receptor with internal deletion in hyperparathyroid tumors with implications for deregulated WNT/beta-catenin signaling.
16890161 2006 Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin.
15588944 2004 Wnt3 modulates the characteristics and cobblestone area-supporting activity of human stromal cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15293277 2004 Novel haplotypes in 17q21 are associated with progressive supranuclear palsy.
14872406 2004 Homozygous WNT3 mutation causes tetra-amelia in a large consanguineous family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11788904 2002 Regulation of WNT3 and WNT3A mRNAs in human cancer cell lines NT2, MCF-7, and MKN45.
11604997 2001 Molecular cloning and characterization of human WNT3.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10557084 1999 Human frizzled 1 interacts with transforming Wnts to transduce a TCF dependent transcriptional response.
10431240 1999 Requirement for Wnt3 in vertebrate axis formation.
8244403 1993 Molecular cloning and chromosomal localization to 17q21 of the human WNT3 gene.
8168088 1994 Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.
1846319 1991 A new nomenclature for int-1 and related genes: the Wnt gene family.