Property Summary

NCBI Gene PubMed Count 51
Grant Count 23
R01 Count 19
Funding $2,403,421.49
PubMed Score 105.12
PubTator Score 104.86

Knowledge Summary

Patent (4,239)

Expression

  Differential Expression (10)

Disease log2 FC p
oligodendroglioma -1.100 0.033
osteosarcoma -2.660 0.000
glioblastoma -1.600 0.006
medulloblastoma -2.100 0.000
cystic fibrosis -2.381 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -2.000 0.000
Breast cancer -3.500 0.025
pediatric high grade glioma -1.400 0.006

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2415 screening 1 / 0 / 0 Mode of Action - subtype specificity assay for ztz240, a potentiator of KCNQ2 potassium channels
623986 confirmatory 0 / 0 / 1 Activators of the GIRK family of Potassium Channels (hKV7.4_ThalliumFlux_CRC)

Gene RIF (42)

PMID Text
26515070 analysis of mechanistic insights into the critical roles of Ca(2+)/CaM regulation of the Kv7.4 channel under physiological and pathological conditions
26036578 genotype-phenotype correlation is analogous to that in KCNQ1 which causes autosomal dominant hereditary long QT syndrome 1 with milder phenotype and the autosomal recessive Jervell and Lange-Nielsen syndrome 1 with more severe phenotype
25941381 Interaction between G-protein betagamma subunits and Kv7.4 is crucial for channel responses to membrane voltage.
25476662 This study provides evidence that mouse Kv7 channels may contribute differently to regulating the functional properties of cerebral and coronary arteries.
25361569 These findings suggest a protective role for Kv7.4 channels in the pulmonary circulation, limiting its reactivity to pressor agents and preventing hypoxia-induced pulmonary hypertension.
25116015 The study identified a novel KCNQ4 mutation in a five generation Chinese family and a known KCNQ4 mutation in a six generation Chinese family.
24927567 Kv7.4 currents are inhibited in a CB1 pathway repressed by endocannabinoid 2-AG
24655070 Identified the c.211delC mutation in the KCNQ4 gene and the c.2967C>A (p.H989Q) mutation in the TECTA gene to be associated with high-frequency sensorineural hearing loss in a Japanese family.
24297175 Differential protein kinase C-dependent modulation of Kv7.4 and Kv7.5 subunits of vascular Kv7 channels.
23750663 decreased cell surface expression and impaired conductance of the KCNQ4 channel are two mechanisms underlying hearing loss in DFNA2
More...

AA Sequence

MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPGPGSGSGSACG      1 - 70
QRSSAAHKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLSTIQEHQELANECLLILEFVMI     71 - 140
VVFGLEYIVRVWSAGCCCRYRGWQGRFRFARKPFCVIDFIVFVASVAVIAAGTQGNIFATSALRSMRFLQ    141 - 210
ILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTIT    211 - 280
LTTIGYGDKTPHTWLGRVLAAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAW    281 - 350
RLYSTDMSRAYLTATWYYYDSILPSFRELALLFEHVQRARNGGLRPLEVRRAPVPDGAPSRYPPVATCHR    351 - 420
PGSTSFCPGESSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQKSWSFNDRTR    421 - 490
FRASLRLKPRTSAEDAPSEEVAEEKSYQCELTVDDIMPAVKTVIRSIRILKFLVAKRKFKETLRPYDVKD    491 - 560
VIEQYSAGHLDMLGRIKSLQTRVDQIVGRGPGDRKAREKGDKGPSDAEVVDEISMMGRVVKVEKQVQSIE    561 - 630
HKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD         631 - 695
//

Text Mined References (50)

PMID Year Title
26515070 2016 Mechanisms of Calmodulin Regulation of Different Isoforms of Kv7.4 K+ Channels.
26036578 2015 A novel frameshift mutation in KCNQ4 in a family with autosomal recessive non-syndromic hearing loss.
25941381 2015 G-protein ?? subunits are positive regulators of Kv7.4 and native vascular Kv7 channel activity.
25476662 2015 Heterogeneity in Kv7 channel function in the cerebral and coronary circulation.
25361569 2015 Role of Kv7 channels in responses of the pulmonary circulation to hypoxia.
25116015 2014 Targeted high-throughput sequencing identifies pathogenic mutations in KCNQ4 in two large Chinese families with autosomal dominant hearing loss.
24927567 2014 The endocannabinoid 2-AG controls skeletal muscle cell differentiation via CB1 receptor-dependent inhibition of Kv7 channels.
24655070 2014 A Japanese family showing high-frequency hearing loss with KCNQ4 and TECTA mutations.
24297175 2014 Differential protein kinase C-dependent modulation of Kv7.4 and Kv7.5 subunits of vascular Kv7 channels.
23750663 2013 Impaired surface expression and conductance of the KCNQ4 channel lead to sensorineural hearing loss.
More...