Property Summary

Ligand Count 6
NCBI Gene PubMed Count 57
PubMed Score 109.25
PubTator Score 104.86

Knowledge Summary

Patent (4,239)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 6.9e-03
atypical teratoid / rhabdoid tumor -2.100 1.3e-05
Breast cancer -3.500 2.5e-02
cystic fibrosis -2.381 5.2e-05
glioblastoma -1.200 5.8e-04
group 4 medulloblastoma -1.300 1.1e-02
medulloblastoma, large-cell -2.300 3.2e-05
oligodendroglioma -1.100 3.3e-02
osteosarcoma -2.660 9.1e-07
primitive neuroectodermal tumor -2.000 7.9e-05

Gene RIF (48)

AA Sequence

MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPGPGSGSGSACG      1 - 70
QRSSAAHKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLSTIQEHQELANECLLILEFVMI     71 - 140
VVFGLEYIVRVWSAGCCCRYRGWQGRFRFARKPFCVIDFIVFVASVAVIAAGTQGNIFATSALRSMRFLQ    141 - 210
ILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTIT    211 - 280
LTTIGYGDKTPHTWLGRVLAAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAW    281 - 350
RLYSTDMSRAYLTATWYYYDSILPSFRELALLFEHVQRARNGGLRPLEVRRAPVPDGAPSRYPPVATCHR    351 - 420
PGSTSFCPGESSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQKSWSFNDRTR    421 - 490
FRASLRLKPRTSAEDAPSEEVAEEKSYQCELTVDDIMPAVKTVIRSIRILKFLVAKRKFKETLRPYDVKD    491 - 560
VIEQYSAGHLDMLGRIKSLQTRVDQIVGRGPGDRKAREKGDKGPSDAEVVDEISMMGRVVKVEKQVQSIE    561 - 630
HKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD         631 - 695
//

Text Mined References (56)

PMID Year Title