Property Summary

NCBI Gene PubMed Count 117
PubMed Score 181.59
PubTator Score 393.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (19)

Disease log2 FC p
aldosterone-producing adenoma -1.314 2.9e-02
Breast cancer -1.200 1.9e-04
chronic rhinosinusitis -1.184 8.7e-03
colon cancer -2.200 1.1e-04
cystic fibrosis 1.134 1.7e-04
ductal carcinoma in situ -1.500 9.7e-04
glioblastoma -1.100 4.5e-02
group 3 medulloblastoma -1.300 6.2e-03
head and neck cancer -1.400 1.3e-02
invasive ductal carcinoma -2.000 2.9e-03
lung cancer -1.600 2.5e-04
medulloblastoma, large-cell -1.200 4.7e-02
non-small cell lung cancer -1.145 2.8e-13
osteosarcoma 2.059 1.8e-04
ovarian cancer 1.200 1.6e-06
primitive neuroectodermal tumor -1.100 3.6e-03
psoriasis -1.200 2.6e-05
subependymal giant cell astrocytoma -1.999 3.1e-02
tuberculosis and treatment for 3 months 1.200 1.5e-04

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (120)

AA Sequence

MPRGEAPGPGRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPSER      1 - 70
RNKPSTLDALNYALRCVHSVQANSEFFQILSQNGAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFL     71 - 140
SGRLVHISEQAALILNRKKDVLASSHFVDLLAPQDMRVFYAHTARAQLPFWNNWTQRAARYECAPVKPFF    141 - 210
CRIRGGEDRKQEKCHSPFRIIPYLIHVHHPAQPELESEPCCLTVVEKIHSGYEAPRIPVNKRIFTTTHTP    211 - 280
GCVFLEVDEKAVPLLGYLPQDLIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPIRFCTQNGDYI    281 - 350
ILDSSWSSFVNPWSRKISFIIGRHKVRTSPLNEDVFATKIKKMNDNDKDITELQEQIYKLLLQPVHVSVS    351 - 420
SGYGSLGSSGSQEQLVSIASSSEASGHRVEETKAEQMTLQQVYASVNKIKNLGQQLYIESMTKSSFKPVT    421 - 490
GTRTEPNGGGECKTFTSFHQTLKNNSVYTEPCEDLRNDEHSPSYQQINCIDSVIRYLKSYNIPALKRKCI    491 - 560
SCTNTTSSSSEEDKQNHKADDVQALQAGLQIPAIPKSEMPTNGRSIDTGGGAPQILSTAMLSLGSGISQC    561 - 630
GYSSTIVHVPPPETARDATLFCEPWTLNMQPAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFREKILS    631 - 700
SPYSSYLQQESRSKAKYSYFQGDSTSKQTRSAGCRKGKHKRKKLPEPPDSSSSNTGSGPRRGAHQNAQPC    701 - 770
CPSAASSPHTSSPTFPPAAMVPSQAPYLVPAFPLPAATSPGREYAAPGTAPEGLHGLPLSEGLQPYPAFP    771 - 840
FPYLDTFMTVFLPDPPVCPLLSPSFLPCPFLGATASSAISPSMSSAMSPTLDPPPSVTSQRREEEKWEAQ    841 - 910
SEGHPFITSRSSSPLQLNLLQEEMPRPSESPDQMRRNTCPQTEYCVTGNNGSESSPATTGALSTGSPPRE    911 - 980
NPSHPTASALSTGSPPMKNPSHPTASALSTGSPPMKNPSHPTASTLSMGLPPSRTPSHPTATVLSTGSPP    981 - 1050
SESPSRTGSAASGSSDSSIYLTSSVYSSKISQNGQQSQDVQKKETFPNVAEEPIWRMIRQTPERILMTYQ   1051 - 1120
VPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAAT   1121 - 1190
SCGQVLVEDSC                                                              1191 - 1201
//

Text Mined References (122)

PMID Year Title