Property Summary

NCBI Gene PubMed Count 112
Grant Count 33
R01 Count 23
Funding $12,135,591.59
PubMed Score 164.29
PubTator Score 393.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma 2.059 0.000
cystic fibrosis 1.134 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.047
primitive neuroectodermal tumor -1.100 0.004
tuberculosis and treatment for 6 months 1.800 0.000
non-small cell lung cancer -1.145 0.000
colon cancer -2.200 0.000
lung cancer -1.600 0.000
group 3 medulloblastoma -1.300 0.006
aldosterone-producing adenoma -1.314 0.029
subependymal giant cell astrocytoma -1.999 0.031
psoriasis -1.200 0.000
Breast cancer -1.200 0.000
ductal carcinoma in situ -1.500 0.001
invasive ductal carcinoma -2.300 0.000
ovarian cancer -1.700 0.000
chronic rhinosinusitis -1.184 0.009
head and neck cancer -1.400 0.013

Gene RIF (115)

PMID Text
26922944 No association between cluster headache, PER3 VNTR polymorphism and chronotype was found in this study.
26903630 A role for PER3 in modulating circadian clock and mood during seasonal changes
26707349 PER3 VNTR polymorphism influences both response to antidepressant chronotherapeutics and total sleep time after the repeated sleep deprivation treatment in patients with bipolar depression.
26624862 The PER1 c.2884C > G polymorphism and PER3 54bp VNTR were associated with annual percent changes in bone mineral density of femoral neck after 1 year of hormone therapy.
26453284 There was no significant association between the PER3 VNTR polymorphism and the irregularity of the menstrual cycle in Korean adolescents.
26440425 PER3 polymorphism is associated with sleep quality after a mild traumatic brain injury.
26406960 This work suggests a role of PER3 rs10462020 in predicting a prognosis in Diffuse large B-cell lymphoma overall survival of patients.
26102236 PER3 VNTR genotype does not explain the difference in chronotype between South African and Dutch marathon runners
25940842 PER3 long allele carriers were more vulnerable to sleep-loss associated attentional lapses than those with the short allele.
25892098 PER3 variants may be associated with decreased risk for depressive symptoms, including subthreshold levels of depressive symptoms, in older adults.
More...

AA Sequence

MPRGEAPGPGRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPSER      1 - 70
RNKPSTLDALNYALRCVHSVQANSEFFQILSQNGAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFL     71 - 140
SGRLVHISEQAALILNRKKDVLASSHFVDLLAPQDMRVFYAHTARAQLPFWNNWTQRAARYECAPVKPFF    141 - 210
CRIRGGEDRKQEKCHSPFRIIPYLIHVHHPAQPELESEPCCLTVVEKIHSGYEAPRIPVNKRIFTTTHTP    211 - 280
GCVFLEVDEKAVPLLGYLPQDLIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPIRFCTQNGDYI    281 - 350
ILDSSWSSFVNPWSRKISFIIGRHKVRTSPLNEDVFATKIKKMNDNDKDITELQEQIYKLLLQPVHVSVS    351 - 420
SGYGSLGSSGSQEQLVSIASSSEASGHRVEETKAEQMTLQQVYASVNKIKNLGQQLYIESMTKSSFKPVT    421 - 490
GTRTEPNGGGECKTFTSFHQTLKNNSVYTEPCEDLRNDEHSPSYQQINCIDSVIRYLKSYNIPALKRKCI    491 - 560
SCTNTTSSSSEEDKQNHKADDVQALQAGLQIPAIPKSEMPTNGRSIDTGGGAPQILSTAMLSLGSGISQC    561 - 630
GYSSTIVHVPPPETARDATLFCEPWTLNMQPAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFREKILS    631 - 700
SPYSSYLQQESRSKAKYSYFQGDSTSKQTRSAGCRKGKHKRKKLPEPPDSSSSNTGSGPRRGAHQNAQPC    701 - 770
CPSAASSPHTSSPTFPPAAMVPSQAPYLVPAFPLPAATSPGREYAAPGTAPEGLHGLPLSEGLQPYPAFP    771 - 840
FPYLDTFMTVFLPDPPVCPLLSPSFLPCPFLGATASSAISPSMSSAMSPTLDPPPSVTSQRREEEKWEAQ    841 - 910
SEGHPFITSRSSSPLQLNLLQEEMPRPSESPDQMRRNTCPQTEYCVTGNNGSESSPATTGALSTGSPPRE    911 - 980
NPSHPTASALSTGSPPMKNPSHPTASALSTGSPPMKNPSHPTASTLSMGLPPSRTPSHPTATVLSTGSPP    981 - 1050
SESPSRTGSAASGSSDSSIYLTSSVYSSKISQNGQQSQDVQKKETFPNVAEEPIWRMIRQTPERILMTYQ   1051 - 1120
VPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAAT   1121 - 1190
SCGQVLVEDSC                                                              1191 - 1201
//

Text Mined References (117)

PMID Year Title
26922944 2015 Lack of association between cluster headache and PER3 clock gene polymorphism.
26903630 2016 A PERIOD3 variant causes a circadian phenotype and is associated with a seasonal mood trait.
26707349 2016 Sleep homeostatic pressure and PER3 VNTR gene polymorphism influence antidepressant response to sleep deprivation in bipolar depression.
26624862 2016 Polymorphisms in period genes and bone response to hormone therapy in postmenopausal Korean women.
26453284 2015 Association between the CLOCK gene 3111 T?>?C polymorphism and an irregular menstrual cycle in Korean adolescents.
26440425 2015 PERIOD3 polymorphism is associated with sleep quality recovery after a mild traumatic brain injury.
26406960 2015 A PER3 polymorphism is associated with better overall survival in diffuse large B-cell lymphoma in Mexican population.
26102236 2015 A chronotype comparison of South African and Dutch marathon runners: The role of scheduled race start times and effects on performance.
25940842 2015 Fighting Sleep at Night: Brain Correlates and Vulnerability to Sleep Loss.
25892098 2015 Associations of PER3 and RORA Circadian Gene Polymorphisms and Depressive Symptoms in Older Adults.
More...