Property Summary

NCBI Gene PubMed Count 41
Grant Count 8
R01 Count 7
Funding $416,638.94
PubMed Score 66.80
PubTator Score 34.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.786 0.002
lung cancer 1.500 0.028
Pick disease -1.100 0.002
progressive supranuclear palsy -1.100 0.033
ovarian cancer -1.500 0.000

Gene RIF (12)

PMID Text
26572236 This insertion of PEX3 into the ER is physiologically relevant.
25062251 Thus within the cell, PEX3 is stabilized by PEX19 preventing PEX3 aggregation.
25002403 PEX16 mediates the peroxisomal trafficking of two distinct peroxisomal membrane proteins, PEX3 and PMP34, via the endoplasmic reticulum
22624858 Mutations in the PEX19-binding domain of PEX3 reduce the affinity for PEX19 and destabilize PEX3.
21102411 The Pex19p peptide contains a characteristic motif, consisting of the leucine triad (Leu18, Leu21, Leu22), and Phe29, which are critical for the Pex3p binding and peroxisome biogenesis.
20554521 The crystal structure of the cytosolic domain of PEX3 in complex with a PEX19-derived peptide. PEX3 adopts a novel fold that is best described as a large helical bundle.
19715730 The cytosolic domain of PEX3, a protein involved in the biogenesis of peroxisomes, binds membrane lipids.
19479899 Pex3p follows the ER-to-peroxisomal route; Pex3p requires Pex16p for ER location but is dispensable for the ER location of Pex16p
18174172 either one or two tryptophan residues of Pex3p (Trp-104 and Trp-224) are directly involved in binding to Pex19p.
16895967 Data suggest that Pex19p probably functions as a chaperone for membrane proteins and transports them to peroxisomes by anchoring to Pex3p using residues 12-73 and 40-131.
More...

AA Sequence

MLRSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVL      1 - 70
SMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSTVAVYSTCMLVVLLRVQLNIIGGYI     71 - 140
YLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELITVIKQAVQKVLGSVSLKHSLSLLDLEQKLK    141 - 210
EIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVL    211 - 280
NTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLT    281 - 350
MEQVKDFAANVYEAFSTPQQLEK                                                   351 - 373
//

Text Mined References (40)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26572236 2016 Human Peroxin PEX3 Is Co-translationally Integrated into the ER and Exits the ER in Budding Vesicles.
25416956 2014 A proteome-scale map of the human interactome network.
25062251 2014 Association between the intrinsically disordered protein PEX19 and PEX3.
25002403 2014 PEX16 contributes to peroxisome maintenance by constantly trafficking PEX3 via the ER.
22624858 2012 The role of conserved PEX3 regions in PEX19-binding and peroxisome biogenesis.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21768384 2011 Sec16B is involved in the endoplasmic reticulum export of the peroxisomal membrane biogenesis factor peroxin 16 (Pex16) in mammalian cells.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21269460 2011 Initial characterization of the human central proteome.
More...