Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.52
PubTator Score 26.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Breast cancer -3.200 1.9e-21
chronic kidney disease 1.400 1.7e-02
Chronic Lymphocytic Leukemia 1.178 2.2e-02
cutaneous lupus erythematosus 1.300 1.2e-02
cystic fibrosis -1.015 1.7e-04
Endometriosis -1.213 2.1e-02
gastric carcinoma 1.500 2.8e-02
glioblastoma 1.900 1.8e-02
group 3 medulloblastoma -1.700 3.0e-03
intraductal papillary-mucinous carcinoma... -1.900 3.2e-02
lung carcinoma -1.100 1.4e-14
malignant mesothelioma -2.300 2.3e-06
medulloblastoma, large-cell -1.800 3.9e-03
non-small cell lung cancer 1.094 1.4e-09
osteosarcoma 2.132 4.1e-03
ovarian cancer 1.100 9.3e-03
pancreatic cancer 1.300 6.8e-04
pancreatic ductal adenocarcinoma liver m... 1.052 8.9e-03
pituitary cancer -1.600 2.4e-04
posterior fossa group A ependymoma 1.100 2.2e-05
psoriasis 1.100 1.5e-02
spina bifida -1.175 1.7e-02
ulcerative colitis 1.700 2.7e-05
urothelial carcinoma -1.500 1.5e-02

Gene RIF (6)

AA Sequence

MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVG      1 - 70
GQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEI     71 - 140
EKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR                      141 - 192
//

Text Mined References (16)

PMID Year Title