Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.49
PubTator Score 26.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 3.73736255945869E-19
lung carcinoma 2844 1.39190922439945E-14
non-small cell lung cancer 2798 1.39786858579826E-9
ovarian cancer 8492 3.15826940937646E-7
group 4 medulloblastoma 1875 1.22791420177598E-6
malignant mesothelioma 3163 2.34421633469776E-6
ulcerative colitis 2087 8.91530352154616E-6
posterior fossa group A ependymoma 1511 2.20249732565973E-5
psoriasis 6685 1.327379570382E-4
pituitary cancer 1972 2.42808670868509E-4
cystic fibrosis 1670 8.94853932057403E-4
medulloblastoma, large-cell 6234 0.00149079319337626
primary pancreatic ductal adenocarcinoma 1271 0.00288240178742924
osteosarcoma 7933 0.00409951801168917
pancreatic cancer 2300 0.00502525755160805
chronic kidney disease 90 0.00657320358657294
cutaneous lupus erythematosus 1056 0.0123920550189338
urothelial carcinoma 318 0.014618062343784
spina bifida 1064 0.0169183603063709
glioblastoma 5572 0.0177802117671655
Endometriosis 535 0.0211354422827474
chronic lymphocytic leukemia 244 0.0224245495234984
gastric carcinoma 832 0.0276431885006621
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0322634034557686
Disease Target Count Z-score Confidence
nail-patella syndrome 16 3.361 1.7

Expression

  Differential Expression (24)

Disease log2 FC p
chronic lymphocytic leukemia 1.178 0.022
urothelial carcinoma -1.500 0.015
malignant mesothelioma -2.300 0.000
cutaneous lupus erythematosus 1.300 0.012
psoriasis 1.700 0.000
osteosarcoma 2.132 0.004
cystic fibrosis 1.400 0.001
glioblastoma 1.900 0.018
group 4 medulloblastoma -2.700 0.000
medulloblastoma, large-cell -2.600 0.001
chronic kidney disease 2.300 0.007
primary pancreatic ductal adenocarcinoma 1.982 0.003
non-small cell lung cancer 1.094 0.000
intraductal papillary-mucinous carcinoma... -1.900 0.032
pancreatic cancer 1.800 0.005
posterior fossa group A ependymoma 1.100 0.000
Endometriosis -1.213 0.021
Breast cancer -3.300 0.000
lung carcinoma -1.100 0.000
spina bifida -1.175 0.017
gastric carcinoma 1.500 0.028
ulcerative colitis 2.400 0.000
ovarian cancer 4.100 0.000
pituitary cancer -1.600 0.000

Synonym

Accession P56559 Q4A519 Q53R10 Q9BVN1 Q9UQ34
Symbols LAK
ARL7

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (4)

PMID Text
25486429 Arl4c is involved in tumorigenesis and might represent a novel therapeutic target for suppressing proliferation and invasion of colorectal and lung cancer cells.
21187453 an important role of LXRs in the coordinated regulation of lipid metabolic and inflammatory gene programs in macrophages
19409876 ARL7 might modulate the intracellular vesicular transport via interaction with microtubules.
17398095 Study shows that three related Arf-like GTPases Arl4a, Arl4c, and Arl4d, are able to recruit ARNO and other cytohesins to the plasma membrane by binding to their PH domains irrespective of whether they are in the diglycine or triglycine form.

AA Sequence

MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVG      1 - 70
GQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEI     71 - 140
EKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR                      141 - 192
//

Text Mined References (14)

PMID Year Title
25486429 2015 Arl4c expression in colorectal and lung cancers promotes tumorigenesis and may represent a novel therapeutic target.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
21187453 2011 Constitutive activation of LXR in macrophages regulates metabolic and inflammatory gene expression: identification of ARL7 as a direct target.
20686608 2010 Genome-wide association study of pancreatic cancer in Japanese population.
19409876 2009 ADP-ribosylation factor like 7 (ARL7) interacts with alpha-tubulin and modulates intracellular vesicular transport.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17398095 2007 The Arl4 family of small G proteins can recruit the cytohesin Arf6 exchange factors to the plasma membrane.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...