Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.97
PubTator Score 0.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Down syndrome 1.400 1.9e-04
active Crohn's disease 1.395 6.3e-03
active ulcerative colitis 1.013 7.3e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.3e-02
malignant mesothelioma -1.100 1.3e-05
medulloblastoma, large-cell -1.400 6.0e-04
Multiple myeloma 1.803 4.0e-03
non-small cell lung cancer -1.080 1.4e-16
osteosarcoma 1.621 1.9e-03
ovarian cancer -1.600 2.7e-05
Pick disease -1.200 1.5e-05
sonic hedgehog group medulloblastoma -1.100 3.1e-04
Waldenstrons macroglobulinemia 1.308 2.7e-02

Synonym

Accession P56557 B2R4L4 D3DSF1 O60537 Q5PY47
Symbols C21orf4
HCVP7TP3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFF      1 - 70
MINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNAL     71 - 140
IFFSTLIYKFGRTEELWT                                                        141 - 158
//

Text Mined References (15)

PMID Year Title