Property Summary

Ligand Count 1
NCBI Gene PubMed Count 19
PubMed Score 477.21
PubTator Score 131.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.400 1.4e-02
Breast cancer 2.700 3.3e-02
ependymoma -1.500 4.0e-02
glioblastoma -1.200 7.3e-05
Multiple myeloma 1.039 1.1e-02
ovarian cancer 1.400 3.9e-05

Gene RIF (6)

AA Sequence

MGKDIRPRSARAACKGVGLWSGCFGKMAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVP      1 - 70
NTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPR     71 - 140
PKDFLSKFYVGHDP                                                            141 - 154
//

Text Mined References (23)

PMID Year Title