Property Summary

NCBI Gene PubMed Count 80
PubMed Score 388.05
PubTator Score 67.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
juvenile dermatomyositis 1189 4.0418510995088E-9
malignant mesothelioma 3163 7.83627983036446E-7
Pick disease 1893 1.10879834634236E-4
dermatomyositis 967 5.32352215287872E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.74332222479088E-4
osteosarcoma 7933 6.55765606686092E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 7.9085867532202E-4
psoriasis 6685 7.95246963738196E-4
primitive neuroectodermal tumor 3031 0.00160720423602929
oligodendroglioma 2849 0.00327605311864585
group 3 medulloblastoma 2254 0.00599297303159604
astrocytoma 1493 0.0119411702269088
invasive ductal carcinoma 2950 0.0155656786186978
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0156067111685647
esophageal adenocarcinoma 737 0.0176010007179145
ependymoma 2514 0.0178980381085414
Barrett's esophagus 185 0.0260825585674251
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0
Prostate cancer 172 0.0 2.0
Disease Target Count Z-score Confidence
Congenital stationary night blindness 28 3.477 1.7

Expression

Gene

PANTHER Protein Class (2)

PDB

2OME   4LCJ  

  Ortholog (6)

Species Source
Macaque OMA EggNOG
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Chicken OMA Inparanoid

Gene RIF (49)

PMID Text
25895816 Releasing the key adipogenic regulator C/EBPalpha from CtBP2 binding.
25820824 Our results indicated that CCNH/CDK7-CtBP2 axis may augment ESCC cell migration, and targeting the interaction of both may provide a novel therapeutic target of esophageal squamous cell carcinoma .
25686837 Enhanced CtBP2expression promoted HCC xenograft growth and induced EMT.
25228652 results show how CtBP2 contributes to prostate cancer progression by modulating AR and oncogenic signaling
24835310 CtBP2 is over-expressed in prostate cancer.CtBP2 promotes prostate cancer cell proliferation through c-Myc signaling.
24657618 Crystal structures of human CtBP1 and CtBP2 in complex with 4-Methylthio 2-oxobutyric acid and NAD.
24522810 Overexpression of CtBP2 is associated with breast carcinoma.
24332637 High CTBP2 expression is associated with prostate cancer.
24012420 CtBP2 directly targeted stem cell core genes resulting in increased cancer cell stemness and increasing metastatic and tumorigenic potential.
23853115 E2F7 recruits the co-repressor C-terminal-binding protein (CtBP) and that CtBP2 is essential for E2F7 to repress E2F1 transcription.
More...

AA Sequence

MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHE      1 - 70
KVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTIC     71 - 140
HILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYD    141 - 210
PYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA    211 - 280
LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP    281 - 350
ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV    351 - 420
AHPSQAPSPNQPTKHGDNREHPNEQ                                                 421 - 445
//

Text Mined References (88)

PMID Year Title
25895816 2015 Obesity-Associated MiR-342-3p Promotes Adipogenesis of Mesenchymal Stem Cells by Suppressing CtBP2 and Releasing C/EBP? from CtBP2 Binding.
25820824 2015 Interaction with CCNH/CDK7 facilitates CtBP2 promoting esophageal squamous cell carcinoma (ESCC) metastasis via upregulating epithelial-mesenchymal transition (EMT) progression.
25728771 2015 MCRIP1, an ERK substrate, mediates ERK-induced gene silencing during epithelial-mesenchymal transition by regulating the co-repressor CtBP.
25686837 2015 CtBP2 is an independent prognostic marker that promotes GLI1 induced epithelial-mesenchymal transition in hepatocellular carcinoma.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25228652 2014 CtBP2 modulates the androgen receptor to promote prostate cancer progression.
24835310 2014 CtBP2 could promote prostate cancer cell proliferation through c-Myc signaling.
24657618 2014 Crystal structures of human CtBP in complex with substrate MTOB reveal active site features useful for inhibitor design.
More...