Tchem | C-terminal-binding protein 2 |
This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2014]
Comments
Disease | Target Count |
---|---|
Malignant neoplasm of prostate | 67 |
Prostatic Neoplasms | 471 |
Disease | Target Count | P-value |
---|---|---|
juvenile dermatomyositis | 1189 | 4.0418510995088E-9 |
malignant mesothelioma | 3163 | 7.83627983036446E-7 |
Pick disease | 1893 | 1.10879834634236E-4 |
dermatomyositis | 967 | 5.32352215287872E-4 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 5.74332222479088E-4 |
osteosarcoma | 7933 | 6.55765606686092E-4 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 7.9085867532202E-4 |
psoriasis | 6685 | 7.95246963738196E-4 |
primitive neuroectodermal tumor | 3031 | 0.00160720423602929 |
oligodendroglioma | 2849 | 0.00327605311864585 |
group 3 medulloblastoma | 2254 | 0.00599297303159604 |
astrocytoma | 1493 | 0.0119411702269088 |
invasive ductal carcinoma | 2950 | 0.0155656786186978 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.0156067111685647 |
esophageal adenocarcinoma | 737 | 0.0176010007179145 |
ependymoma | 2514 | 0.0178980381085414 |
Barrett's esophagus | 185 | 0.0260825585674251 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Multiple Sclerosis | 498 | 0.0 | 1.0 |
Prostate cancer | 172 | 0.0 | 2.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Congenital stationary night blindness | 28 | 3.477 | 1.7 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | 1.200 | 0.000 |
astrocytoma | 1.200 | 0.012 |
ependymoma | 1.200 | 0.018 |
oligodendroglioma | 1.200 | 0.003 |
Barrett's esophagus | 1.200 | 0.026 |
esophageal adenocarcinoma | 1.800 | 0.018 |
psoriasis | 1.400 | 0.001 |
osteosarcoma | -1.237 | 0.001 |
group 3 medulloblastoma | 1.300 | 0.006 |
primitive neuroectodermal tumor | 1.200 | 0.002 |
juvenile dermatomyositis | 1.271 | 0.000 |
pancreatic ductal adenocarcinoma liver m... | 2.923 | 0.001 |
intraductal papillary-mucinous carcinoma... | 1.100 | 0.001 |
intraductal papillary-mucinous neoplasm ... | 1.200 | 0.016 |
Pick disease | 1.100 | 0.000 |
invasive ductal carcinoma | 1.100 | 0.016 |
dermatomyositis | 1.400 | 0.001 |
Species | Source |
---|---|
Macaque | OMA EggNOG |
Mouse | EggNOG Inparanoid |
Rat | EggNOG Inparanoid |
Dog | OMA Inparanoid |
Horse | OMA Inparanoid |
Chicken | OMA Inparanoid |
CHEMBL3797935
pIC50 6.05
CHEMBL3799251
pIC50 6.06
CHEMBL3799689
pIC50 6.14
CHEMBL3800187
pIC50 6.32
CHEMBL3800006
pIC50 6.50
CHEMBL3800609
pIC50 6.52
CHEMBL3797778
pIC50 6.62
CHEMBL3798669
pIC50 6.75
CHEMBL3799940
pIC50 6.77
PMID | Text |
---|---|
25895816 | Releasing the key adipogenic regulator C/EBPalpha from CtBP2 binding. |
25820824 | Our results indicated that CCNH/CDK7-CtBP2 axis may augment ESCC cell migration, and targeting the interaction of both may provide a novel therapeutic target of esophageal squamous cell carcinoma . |
25686837 | Enhanced CtBP2expression promoted HCC xenograft growth and induced EMT. |
25228652 | results show how CtBP2 contributes to prostate cancer progression by modulating AR and oncogenic signaling |
24835310 | CtBP2 is over-expressed in prostate cancer.CtBP2 promotes prostate cancer cell proliferation through c-Myc signaling. |
24657618 | Crystal structures of human CtBP1 and CtBP2 in complex with 4-Methylthio 2-oxobutyric acid and NAD. |
24522810 | Overexpression of CtBP2 is associated with breast carcinoma. |
24332637 | High CTBP2 expression is associated with prostate cancer. |
24012420 | CtBP2 directly targeted stem cell core genes resulting in increased cancer cell stemness and increasing metastatic and tumorigenic potential. |
23853115 | E2F7 recruits the co-repressor C-terminal-binding protein (CtBP) and that CtBP2 is essential for E2F7 to repress E2F1 transcription. |
More... |
MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHE 1 - 70 KVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTIC 71 - 140 HILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYD 141 - 210 PYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA 211 - 280 LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP 281 - 350 ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV 351 - 420 AHPSQAPSPNQPTKHGDNREHPNEQ 421 - 445 //
PMID | Year | Title |
---|---|---|
25895816 | 2015 | Obesity-Associated MiR-342-3p Promotes Adipogenesis of Mesenchymal Stem Cells by Suppressing CtBP2 and Releasing C/EBP? from CtBP2 Binding. |
25820824 | 2015 | Interaction with CCNH/CDK7 facilitates CtBP2 promoting esophageal squamous cell carcinoma (ESCC) metastasis via upregulating epithelial-mesenchymal transition (EMT) progression. |
25728771 | 2015 | MCRIP1, an ERK substrate, mediates ERK-induced gene silencing during epithelial-mesenchymal transition by regulating the co-repressor CtBP. |
25686837 | 2015 | CtBP2 is an independent prognostic marker that promotes GLI1 induced epithelial-mesenchymal transition in hepatocellular carcinoma. |
25429064 | 2015 | Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
25231870 | 2014 | Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche. |
25228652 | 2014 | CtBP2 modulates the androgen receptor to promote prostate cancer progression. |
24835310 | 2014 | CtBP2 could promote prostate cancer cell proliferation through c-Myc signaling. |
24657618 | 2014 | Crystal structures of human CtBP in complex with substrate MTOB reveal active site features useful for inhibitor design. |
More... |