Property Summary

Ligand Count 9
NCBI Gene PubMed Count 88
PubMed Score 410.66
PubTator Score 67.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.100 4.3e-02
Barrett's esophagus 1.200 2.6e-02
dermatomyositis 1.400 5.3e-04
ependymoma 1.200 1.8e-02
esophageal adenocarcinoma 1.800 1.8e-02
group 3 medulloblastoma 1.100 4.8e-02
intraductal papillary-mucinous carcinoma... 1.100 5.7e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.6e-02
invasive ductal carcinoma 1.100 1.6e-02
juvenile dermatomyositis 1.271 4.0e-09
malignant mesothelioma 1.200 7.8e-07
oligodendroglioma 1.200 3.3e-03
osteosarcoma -1.237 6.6e-04
pancreatic ductal adenocarcinoma liver m... 1.166 2.2e-02
Pick disease 1.100 1.1e-04
primitive neuroectodermal tumor 1.100 8.0e-04
psoriasis 1.400 8.0e-04

Gene RIF (54)

AA Sequence

MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHE      1 - 70
KVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTIC     71 - 140
HILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYD    141 - 210
PYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA    211 - 280
LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP    281 - 350
ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV    351 - 420
AHPSQAPSPNQPTKHGDNREHPNEQ                                                 421 - 445
//

Text Mined References (96)

PMID Year Title