Property Summary

NCBI Gene PubMed Count 115
PubMed Score 381.87
PubTator Score 267.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 4.0e-20
osteosarcoma 7950 1.5e-03
Disease Target Count Z-score Confidence
Disease of mental health 36 0.0 1.4
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Long QT syndrome 39 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.521 1.5e-03
psoriasis -1.900 4.0e-20

Gene RIF (77)

AA Sequence

MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKY      1 - 70
WCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVC     71 - 140
SSIKVVLRKEV                                                               141 - 151
//

Text Mined References (117)

PMID Year Title