Property Summary

NCBI Gene PubMed Count 47
Grant Count 6
R01 Count 6
Funding $687,435.9
PubMed Score 61.83
PubTator Score 62.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

Gene RIF (18)

PMID Text
26462016 Propose that eIF6 is necessary for malignant pleural mesothelioma growth.
25886394 EIF6 plays an important role in controlling cell motility and tumor metastasis.
25252159 eIF6 is a node regulator of ribosomal function and predict that prioritizing its pharmacological targeting will be of benefit in cancer and Shwachman-Bodian-Diamond syndrome
23115272 SBDS protein facilitates the release of eIF6, a factor that prevents ribosome joining.
22415777 Inhibiting the induction of two proteins involved in two of the most significantly upregulated cellular processes, ribosome biogenesis (eIF6) and hnRNA splicing (SF3B2/SF3B4), showed that human T cells can enter the cell cycle without growing in size.
22365962 The interactions between P311 and ITGB4BP may be very important in the process of tumor cell differentiation and metastasis.
22348144 eIF6 is one of the downstream effectors of Notch-1 in the pathway that controls cell motility and invasiveness in tumor cell lines
22295858 The benign prognosis of the Shwachman-Diamond syndrome patients with the int del (20)(q11.21q13.32) may be due to a gene/dosage effect for the EIF6 protein.
21536732 a direct role for SBDS and EFL1 in catalyzing the translational activation of ribosomes in all eukaryotes, and define SDS as a ribosomopathy caused by uncoupling GTP hydrolysis from eIF6 release
21084295 Ca(2+)-activated calcineurin phosphatase binds to and promotes nuclear localization of eIF6.Nuclear export of eIF6 is regulated by phosphorylation at Ser-174 and Ser-175 by the nuclear isoform of CK1.
More...

AA Sequence

MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGL      1 - 70
LVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQ     71 - 140
TVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT    141 - 210
TSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT                                       211 - 245
//

Text Mined References (54)

PMID Year Title
26462016 2015 Expression and activity of eIF6 trigger malignant pleural mesothelioma growth in vivo.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25886394 2015 EIF6 over-expression increases the motility and invasiveness of cancer cells by modulating the expression of a critical subset of membrane-bound proteins.
25252159 2015 eIF6 anti-association activity is required for ribosome biogenesis, translational control and tumor progression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23115272 2012 Impaired ribosomal subunit association in Shwachman-Diamond syndrome.
22415777 2012 Proteomic and protein interaction network analysis of human T lymphocytes during cell-cycle entry.
22365962 2012 Identification of ITGB4BP as a new interaction protein of P311.
More...