Property Summary

NCBI Gene PubMed Count 49
PubMed Score 66.62
PubTator Score 62.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
HIV Infections 102 0.0 0.0
Disease Target Count
Mammary Neoplasms 425

Expression

Gene RIF (20)

AA Sequence

MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGL      1 - 70
LVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQ     71 - 140
TVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT    141 - 210
TSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT                                       211 - 245
//

Text Mined References (56)

PMID Year Title