Property Summary

NCBI Gene PubMed Count 164
Grant Count 143
R01 Count 100
Funding $13,536,763.87
PubMed Score 235.95
PubTator Score 202.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession P56524 E9PGB9 F5GX36 Q86YH7 Q9UND6 HD4
Symbols HD4
AHO3
BDMR
HDACA
HA6116
HDAC-4
HDAC-A

Gene

PANTHER Protein Class (2)

PDB

3UZD   3UXG   3V31   2H8N   2O94   2VQJ   2VQM   2VQO   2VQQ   2VQV   2VQW   4CBT   4CBY   5A2S  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651928 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC4

Gene RIF (97)

PMID Text
27106144 Mechanical compression regulates chondrocyte gene expression through HDAC4 relocation from the cell's cytoplasm to the nucleus via PP2A-dependent HDAC4 dephosphorylation.
26619800 Over-expression of HDAC4 suppressed the transcription of genes involved in energy expenditure in a SIRT1-dependent manner. In contrast, HDAC4 knockdown/inhibition neutralized the effect of IFN-gamma on cellular metabolism by normalizing SIRT1 expression
26572940 we demonstrate that nuclear HDAC4 is a key regulator promoting the progressive epithelial ovarian cancer on fibrillar collagen matrices
26568966 downregulated in sustained virologic responders compared to the spontaneous clearers of Hepatitis C
26540094 HDAC4 destabilizes MAP1S, suppresses autophagy flux and promotes the accumulation of mHTT aggregates.
26502922 Elevated HDAC-4 expression in Pancreatic Adenocarcinoma was significantly associated with the absence of organ metastases and borderline with the absence of lymph node metastases and tumor proliferative capacity.
26455434 HDAC4-RelB-p52 complex maintains repressive chromatin around proapoptotic genes Bim and BMF and regulates multiple myeloma survival and growth
26437241 the pro-inflammatory role of miR-22 in emphysema has revealed that HDAC4 specifically regulated smoking-related lung inflammation and TH17 responses
26414199 HDAC4 increases endogenous SIRT1 expression by enhancing its sumoylation modification levels
26305553 Among the class II HDACs, HDAC4 interacted with both MR and HDAC3 after aldosterone stimulation. The nuclear translocation of HDAC4 was mediated by protein kinase A (PKA) and protein phosphatases (PP)
More...

AA Sequence

MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQ      1 - 70
LQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQE     71 - 140
QELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSS    141 - 210
LDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTAL    211 - 280
KKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPS    281 - 350
LPNITLGLPATGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL    351 - 420
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFL    421 - 490
EKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPYLDRLPGQKEAHAQAGVQVKQ    491 - 560
EPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRA    561 - 630
QSSPASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCEC    631 - 700
IRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGA    701 - 770
ARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD    771 - 840
VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAA    841 - 910
FRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTA    911 - 980
ICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCEN    981 - 1050
EEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL                                       1051 - 1084
//

Text Mined References (175)

PMID Year Title
27106144 2016 Compression regulates gene expression of chondrocytes through HDAC4 nuclear relocation via PP2A-dependent HDAC4 dephosphorylation.
26619800 2016 HDAC4 mediates IFN-? induced disruption of energy expenditure-related gene expression by repressing SIRT1 transcription in skeletal muscle cells.
26572940 2016 Histone deacetylase 4 increases progressive epithelial ovarian cancer cells via repression of p21 on fibrillar collagen matrices.
26568966 2015 Peripheral Blood Mononuclear Cell Gene Expression Remains Broadly Altered Years after Successful Interferon-Based Hepatitis C Virus Treatment.
26540094 2015 Blocking the association of HDAC4 with MAP1S accelerates autophagy clearance of mutant Huntingtin.
26502922 2015 Histone deacetylase (HDAC)-1, -2, -4 and -6 expression in human pancreatic adenocarcinoma: associations with clinicopathological parameters, tumor proliferative capacity and patients' survival.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26455434 2015 Transcriptional repression by the HDAC4-RelB-p52 complex regulates multiple myeloma survival and growth.
26437241 2015 The microRNA miR-22 inhibits the histone deacetylase HDAC4 to promote T(H)17 cell-dependent emphysema.
26414199 2016 HDAC4 stabilizes SIRT1 via sumoylation SIRT1 to delay cellular senescence.
More...