Property Summary

Ligand Count 3
NCBI Gene PubMed Count 35
PubMed Score 2005.93
PubTator Score 477.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Barrett's esophagus 5.000 2.0e-02
colon cancer -1.900 4.2e-03
esophageal adenocarcinoma 5.200 1.8e-02
interstitial cystitis -2.000 3.9e-02
intraductal papillary-mucinous adenoma (... 2.300 7.3e-03
intraductal papillary-mucinous carcinoma... 3.100 2.6e-03
intraductal papillary-mucinous neoplasm ... 2.600 1.7e-02
lung adenocarcinoma 1.300 2.4e-03
pancreatic cancer 2.000 2.9e-04
psoriasis -1.100 3.7e-14
urothelial carcinoma -2.800 1.5e-02

 GO Process (1)

PDB (12)

Gene RIF (29)

AA Sequence

MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDG      1 - 70
WDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDG     71 - 140
DLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIII    141 - 210
KGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRC    211 - 280
GLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI                               281 - 323
//

Text Mined References (35)

PMID Year Title