Property Summary

NCBI Gene PubMed Count 31
Grant Count 636
R01 Count 339
Funding $115,032,553.71
PubMed Score 1921.60
PubTator Score 477.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P56470 Gal-4
Symbols GAL4
L36LBP

Gene

PANTHER Protein Class (1)

PDB

1X50   4XZP   4YLZ   4YM0   4YM1   4YM2   4YM3   5CBL   5DUU   5DUV   5DUW   5DUX  

 GO Process (1)

Gene RIF (25)

PMID Text
26891020 The integrative analysis of galectins(Gal-1, -3, -4, -9) discriminated IBD from other intestinal inflammatory conditions and could be used as potential mucosal biomarker
26885508 Galectin-1 was undetectable in normal and ulcerative colitis colonic epithelium, while galectin-2, galectin-3, and galectin-4 were strongly expressed.
26505429 The data suggests that arm-Gal4 has detrimental effects on Drosophila development and lifespan that are directly dependent upon parental inheritance
26481311 The co-expression of galectin-4 and CNT3 proteins is not impaired in inflamed colon from patients with Crohn's disease, thereby anticipating the integrity of this system for drug targeting.
26432949 The carbohydrate-binding site is composed of residues His236, Asn238, Arg240, Asn249, Trp256, Glu259 and Lys261 at the strands S4, S5 and S6.
26173257 some galectins, particularly galectin-3 and -4, showed the ability to drive clathrin-independent mechanisms of endocytosis.
26077389 Structural characterization of human galectin 4 C-terminal domain in terms its ligands binding specificity has been reported.
25230111 The results show galectin-4 expression closely associates with hepatocellular carcinoma (HCC) progression and might have potential use as a prognostic biomarker for HCC patients.
25179596 role in basolateral to apical epithelial transcytosis
24859692 Results suggest that galectin-3, -4, -7 and -9 could be involved in the biology of inverted papillomas.
More...

AA Sequence

MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDG      1 - 70
WDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDG     71 - 140
DLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIII    141 - 210
KGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRC    211 - 280
GLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI                               281 - 323
//

Text Mined References (31)

PMID Year Title
26891020 A galectin-specific signature in the gut delineates Crohn's disease and ulcerative colitis from other human inflammatory intestinal disorders.
26885508 2016 Immunohistochemical Studies on Galectin Expression in Colectomised Patients with Ulcerative Colitis.
26505429 2015 Arm-Gal4 inheritance influences development and lifespan in Drosophila melanogaster.
26481311 2016 Galectin-4 interacts with the drug transporter human concentrative nucleoside transporter 3 to regulate its function.
26432949 2016 Recombinant expression, purification and preliminary biophysical and structural studies of C-terminal carbohydrate recognition domain from human galectin-4.
26173257 2015 Assembly, organization and regulation of cell-surface receptors by lectin-glycan complexes.
26077389 2015 Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
25230111 2014 Galectin-4 serves as a prognostic biomarker for the early recurrence / metastasis of hepatocellular carcinoma.
25179596 2014 Galectin-4-mediated transcytosis of transferrin receptor.
24859692 2014 Galectin fingerprinting in naso-sinusal diseases.
More...