Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.14
PubTator Score 2.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytoma -1.100 0.003
Pneumonia -1.100 0.010

Synonym

Accession P56385 Q0D2L9 ATPase subunit e
Symbols ATP5K

Gene

Gene RIF (5)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E (ATP5I) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18060860 The inhibitory activity against mitochondria and F(1)F(0)-ATP synthase is not limited to atrazine but is likely to be applicable to other triazine-based compounds.
16682002 This is the first report identifying caspase-3 as a substrate protein of Hsp90.
11939412 results suggest that antisense of hAS-e can inhibit cell proliferation through the MAP kinase pathway

AA Sequence

MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK       1 - 69
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
18060860 2008 Atrazine binds to F1F0-ATP synthase and inhibits mitochondrial function in sperm.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16682002 2006 F1F0-ATP synthase functions as a co-chaperone of Hsp90-substrate protein complexes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...