Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.34
PubTator Score 2.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
astrocytoma 1146 3.0e-03
Pneumonia 174 9.8e-03

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytoma -1.100 3.0e-03
Pneumonia -1.100 9.8e-03

Gene RIF (5)

AA Sequence

MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK       1 - 69
//

Text Mined References (23)

PMID Year Title