Property Summary

NCBI Gene PubMed Count 20
PubMed Score 69.57
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.300 1.4e-03
Multiple myeloma 1.378 1.6e-03
osteosarcoma -1.002 3.4e-04
Pneumonia -1.100 4.7e-02
Polycystic ovary syndrome 1.185 4.1e-03

Gene RIF (5)

AA Sequence

MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE                         1 - 51
//

Text Mined References (23)

PMID Year Title