Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
Funding $7,971.37
PubMed Score 66.50
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.378 0.002
osteosarcoma -4.209 0.000
diabetes mellitus -1.300 0.001
Pneumonia -1.100 0.047
Polycystic Ovary Syndrome 1.185 0.004

Synonym

Accession P56381 B2RDD0 E1P5H6 Q53XU6 ATPase subunit epsilon
Symbols ATPE
MC5DN3

Gene

 Grant Application (2)

 MGI Term (1)

Gene RIF (5)

PMID Text
26079849 ATP5E transcript alteration (down-expression) was highly associated to PTC diagnosis
24067918 The cell surface F1/F0 ATP synthase complex plays a key role in the acidic microenvironment of tumor tissues.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20026007 the epsilon subunit is essential for the assembly of F1 and plays an important role in the incorporation of the hydrophobic subunit c into the F1-c oligomer rotor of the mitochondrial ATP synthase complex
19016746 Galectin 3 co-localized with ATP synthase in the inner membrane of mitochondria and had an inhibitory effect on ATP synthase in human colon cancer cells.

AA Sequence

MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE                         1 - 51
//

Text Mined References (23)

PMID Year Title
26079849 2015 Molecular Analysis by Gene Expression of Mitochondrial ATPase Subunits in Papillary Thyroid Cancer: Is ATP5E Transcript a Possible Early Tumor Marker?
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24067918 2013 Cell surface F1/FO ATP synthase contributes to interstitial flow-mediated development of the acidic microenvironment in tumor tissues.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20566710 2010 Mitochondrial ATP synthase deficiency due to a mutation in the ATP5E gene for the F1 epsilon subunit.
20026007 Knockdown of F1 epsilon subunit decreases mitochondrial content of ATP synthase and leads to accumulation of subunit c.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19016746 2008 Identification of mitochondrial F(1)F(0)-ATP synthase interacting with galectin-3 in colon cancer cells.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...