Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
R01 Count 1
Funding $151,412.5
PubMed Score 6.88
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.573 0.009
Multiple myeloma 2.076 0.000
astrocytoma -2.700 0.000
ependymoma -2.200 0.007
oligodendroglioma -1.500 0.023
glioblastoma -2.000 0.001
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma -1.400 0.000
primitive neuroectodermal tumor -1.300 0.003
lung cancer 1.600 0.000
Breast cancer 2.600 0.027
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.700 0.000
Pick disease -1.100 0.002
ovarian cancer 1.800 0.000

Synonym

Accession P56378 B2R588 G3V5Q3 Q86TT7
Symbols MP68
PLPM

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
24330338 MLQ is a potential regulator of the mitochondrial ATP synthesis

AA Sequence

MLQSIIKNIWIPMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH                  1 - 58
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24330338 2014 Population of ATP synthase molecules in mitochondria is limited by available 6.8-kDa proteolipid protein (MLQ).
21269460 2011 Initial characterization of the human central proteome.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...