Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.74
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.900 1.3e-06
astrocytic glioma -2.000 4.3e-03
Astrocytoma, Pilocytic -1.700 2.5e-08
atypical teratoid / rhabdoid tumor -1.300 3.4e-05
Breast cancer 2.600 2.7e-02
ependymoma -2.200 6.8e-03
glioblastoma -1.500 2.6e-08
group 4 medulloblastoma -1.400 6.7e-06
lung cancer 1.200 9.0e-04
Multiple myeloma 2.076 2.6e-04
oligodendroglioma -1.500 2.3e-02
ovarian cancer 1.800 4.3e-04
Pick disease -1.100 1.7e-03
primitive neuroectodermal tumor -1.300 3.3e-03
Waldenstrons macroglobulinemia 1.573 9.2e-03

Gene RIF (1)

AA Sequence

MLQSIIKNIWIPMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH                  1 - 58
//

Text Mined References (14)

PMID Year Title