Property Summary

NCBI Gene PubMed Count 19
PubMed Score 490.90
PubTator Score 11.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Intellectual disability 1016 3.318 1.7
Disease Target Count Z-score Confidence
Postgastrectomy syndrome 2 4.327 2.2

Expression

  Differential Expression (31)

Gene RIF (22)

AA Sequence

MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAI      1 - 70
EDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLL     71 - 140
QEEAETPRSVLEEIGLT                                                         141 - 157
//

Text Mined References (22)

PMID Year Title