Property Summary

NCBI Gene PubMed Count 39
Grant Count 80
R01 Count 57
Funding $10,621,407.75
PubMed Score 341.20
PubTator Score 139.29

Knowledge Summary

Patent (19,499)

Expression

Synonym

Accession P56373 Q6DK37 Q9UQB6 P2X3
Symbols P2X3

Gene

  TechDev Info (1)

Susumu Tomita Examining potential modulators

Gene RIF (30)

PMID Text
26517690 Data indicate P2X3 purinergic receptors as potential new targets for hepatocellular carcinoma (HCC) therapy.
26253104 The results from this study demonstrate that there is a significant difference in the expression of the purinergic P2X2, P2X3 and P2X7 receptors in the different histological layers of the human urinary bladder.
26241848 Urothelial P2X3 receptors decreased significantly in responders after Lipotoxin instillation, but not after BoNT-A injection.
26184350 Results demonstrate that the stoichiometry of the heterotrimeric hP2X2/3 receptor is not fixed, but determined by the relative availability of P2X2 and P2X3 subunits
25336328 esophagitis increases mRNA expressions of P2X3 and P2X7 receptors accompanied by up-regulation of TRPV1 and neurotrophic factors (NGF and GDNF).
24989924 Conformational flexibility of the agonist binding jaw of the human P2X3 receptor is a prerequisite for channel opening
24868547 sensory proteins P2X3 and TRPV1 are in correlation with urothelial differentiation, while P2X5 and TRPV4 have unique expression patterns
24764033 TRPV1-, TRPV2-, P2X3-, and parvalbumin-immunoreactivity neurons in the human nodose ganglion innervate the pharynx and epiglottis through the pharyngeal branch and superior laryngeal nerve
24223907 Data indicate that Markov models are suitable to simulate agonist antagonist interactions at fast desensitizing receptors such as the P2X3R.
23959888 Data indicate that MgATP2- activates P2X1 and P2X3, but not P2X2 and P2X4 receptors.
More...

AA Sequence

MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSVVTKVKGSGLY      1 - 70
ANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGPERLPGGGILTGRCVNY     71 - 140
SSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIRFPLFNFEKGNLLPNLTARDMKTCRFHPDKD    141 - 210
PFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNF    211 - 280
RFAKYYKMENGSEYRTLLKAFGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGA    281 - 350
DQYKAKKFEEVNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH                           351 - 397
//

Text Mined References (41)

PMID Year Title
26517690 2015 P2X3 purinergic receptor overexpression is associated with poor recurrence-free survival in hepatocellular carcinoma patients.
26253104 2015 Localization of P2X receptor subtypes 2, 3 and 7 in human urinary bladder.
26241848 2015 Presence of Cleaved Synaptosomal-Associated Protein-25 and Decrease of Purinergic Receptors P2X3 in the Bladder Urothelium Influence Efficacy of Botulinum Toxin Treatment for Overactive Bladder Syndrome.
26184350 2015 Flexible subunit stoichiometry of functional human P2X2/3 heteromeric receptors.
25336328 2014 Evidence for up-regulation of purinergic receptor genes associating with TRPV1 receptors and neurotrophic factors in the inflamed human esophagus.
24989924 2014 Conformational flexibility of the agonist binding jaw of the human P2X3 receptor is a prerequisite for channel opening.
24868547 2014 Correlation between urothelial differentiation and sensory proteins P2X3, P2X5, TRPV1, and TRPV4 in normal urothelium and papillary carcinoma of human bladder.
24764033 2014 Distribution of TRPVs, P2X3, and parvalbumin in the human nodose ganglion.
24223907 2013 Agonist antagonist interactions at the rapidly desensitizing P2X3 receptor.
23959888 2013 Subtype-specific control of P2X receptor channel signaling by ATP and Mg2+.
More...