Property Summary

Ligand Count 822
NCBI Gene PubMed Count 61
PubMed Score 360.18
PubTator Score 139.29

Knowledge Summary

Patent (19,499)

Expression

Gene RIF (36)

AA Sequence

MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSVVTKVKGSGLY      1 - 70
ANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGPERLPGGGILTGRCVNY     71 - 140
SSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIRFPLFNFEKGNLLPNLTARDMKTCRFHPDKD    141 - 210
PFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNF    211 - 280
RFAKYYKMENGSEYRTLLKAFGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGA    281 - 350
DQYKAKKFEEVNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH                           351 - 397
//

Text Mined References (63)

PMID Year Title