Property Summary

NCBI Gene PubMed Count 18
Grant Count 2
Funding $210,430.5
PubMed Score 16.80
PubTator Score 12.37

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25924900 Inhibition of DNA polymerases a, delra and e by AFP promoter-driven artificial microRNAs may lead to effective growth arrest of AFP-positive HCC cells,as novel strategy for gene therapy
20065316 found that mutations occurred in POLE2 in 5 out of 16 cases of human colon cancer examined.
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18676977 The solution structure of the N-terminal domain of human DNA polymerase epsilon subunit B revealed a domain that consists of a left-handed superhelical bundle.

AA Sequence

MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAA      1 - 70
VQECSQSVDETIEHVFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNLFGTPRDKAEMFRERYTILHQR     71 - 140
THRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGDAIVLGMITQLKEGKFFLEDPTGTVQLDLSK    141 - 210
AQFHSGLYTEACFVLAEGWFEDQVFHVNAFGFPPTEPSSTTRAYYGNINFFGGPSNTSVKTSAKLKQLEE    211 - 280
ENKDAMFVFLSDVWLDQVEVLEKLRIMFAGYSPAPPTCFILCGNFSSAPYGKNQVQALKDSLKTLADIIC    281 - 350
EYPDIHQSSRFVFVPGPEDPGFGSILPRPPLAESITNEFRQRVPFSVFTTNPCRIQYCTQEITVFREDLV    351 - 420
NKMCRNCVRFPSSNLAIPNHFVKTILSQGHLTPLPLYVCPVYWAYDYALRVYPVPDLLVIADKYDPFTTT    421 - 490
NTECLCINPGSFPRSGFSFKVFYPSNKTVEDSKLQGF                                     491 - 527
//

Text Mined References (20)

PMID Year Title
25924900 2015 DNA Polymerases as targets for gene therapy of hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
20065316 Mutations/polymorphisms in the 55 kDa subunit of DNA polymerase epsilon in human colorectal cancer.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
18676977 2008 The solution structure of the amino-terminal domain of human DNA polymerase epsilon subunit B is homologous to C-domains of AAA+ proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
More...