Property Summary

NCBI Gene PubMed Count 21
PubMed Score 16.80
PubTator Score 12.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -1.900 7.2e-03
adrenocortical carcinoma 1.331 3.2e-03
adult high grade glioma 2.000 3.4e-06
Astrocytoma, Pilocytic 1.600 2.1e-09
atypical teratoid / rhabdoid tumor 2.800 3.7e-11
Breast cancer 3.100 2.4e-02
ductal carcinoma in situ 1.100 1.5e-03
ependymoma 1.600 3.0e-09
glioblastoma 2.300 7.1e-12
group 3 medulloblastoma 2.800 4.9e-07
intraductal papillary-mucinous carcinoma... 1.300 3.6e-03
intraductal papillary-mucinous neoplasm ... 1.900 1.6e-03
invasive ductal carcinoma 1.600 6.2e-04
lung cancer 2.300 3.8e-03
medulloblastoma, large-cell 3.500 8.1e-08
non-small cell lung cancer 2.020 6.7e-22
osteosarcoma -1.668 3.1e-02
ovarian cancer 1.200 1.2e-04
primitive neuroectodermal tumor 2.700 2.5e-06
psoriasis 1.100 5.5e-35

Protein-protein Interaction (5)

Gene RIF (4)

AA Sequence

MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAA      1 - 70
VQECSQSVDETIEHVFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNLFGTPRDKAEMFRERYTILHQR     71 - 140
THRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGDAIVLGMITQLKEGKFFLEDPTGTVQLDLSK    141 - 210
AQFHSGLYTEACFVLAEGWFEDQVFHVNAFGFPPTEPSSTTRAYYGNINFFGGPSNTSVKTSAKLKQLEE    211 - 280
ENKDAMFVFLSDVWLDQVEVLEKLRIMFAGYSPAPPTCFILCGNFSSAPYGKNQVQALKDSLKTLADIIC    281 - 350
EYPDIHQSSRFVFVPGPEDPGFGSILPRPPLAESITNEFRQRVPFSVFTTNPCRIQYCTQEITVFREDLV    351 - 420
NKMCRNCVRFPSSNLAIPNHFVKTILSQGHLTPLPLYVCPVYWAYDYALRVYPVPDLLVIADKYDPFTTT    421 - 490
NTECLCINPGSFPRSGFSFKVFYPSNKTVEDSKLQGF                                     491 - 527
//

Text Mined References (23)

PMID Year Title