Property Summary

NCBI Gene PubMed Count 18
PubMed Score 16.80
PubTator Score 12.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 6.68110997926589E-22
psoriasis 6685 5.71498246578008E-18
atypical teratoid / rhabdoid tumor 4369 3.68973340681899E-11
pilocytic astrocytoma 3086 2.10340750566235E-9
posterior fossa group A ependymoma 1511 3.11258207358399E-9
pediatric high grade glioma 2712 5.22549624129992E-8
sonic hedgehog group medulloblastoma 1482 6.64336229087858E-8
medulloblastoma, large-cell 6234 8.10992081424249E-8
primitive neuroectodermal tumor 3031 2.52183606790328E-6
glioblastoma 5572 2.8551475894824E-6
lung cancer 4473 4.52386999104372E-5
ovarian cancer 8492 1.20279334400943E-4
invasive ductal carcinoma 2950 6.16958103281342E-4
ductal carcinoma in situ 1745 0.00152227022187353
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0015884399065195
adrenocortical carcinoma 1427 0.00316525363573634
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00359602170246309
acute myeloid leukemia 785 0.00720044527230895
Breast cancer 3099 0.0237535027308865
osteosarcoma 7933 0.0305301958282873
Disease Target Count Z-score Confidence
Seckel syndrome 35 3.312 1.7

Expression

Synonym

Accession P56282 A0AV55 A4FU92 A4LBB7 A6NH58 B4DDE6 O43560
Symbols DPE2

Gene

PDB

2V6Z  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (4)

PMID Text
25924900 Inhibition of DNA polymerases a, delra and e by AFP promoter-driven artificial microRNAs may lead to effective growth arrest of AFP-positive HCC cells,as novel strategy for gene therapy
20065316 found that mutations occurred in POLE2 in 5 out of 16 cases of human colon cancer examined.
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18676977 The solution structure of the N-terminal domain of human DNA polymerase epsilon subunit B revealed a domain that consists of a left-handed superhelical bundle.

AA Sequence

MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAA      1 - 70
VQECSQSVDETIEHVFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNLFGTPRDKAEMFRERYTILHQR     71 - 140
THRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGDAIVLGMITQLKEGKFFLEDPTGTVQLDLSK    141 - 210
AQFHSGLYTEACFVLAEGWFEDQVFHVNAFGFPPTEPSSTTRAYYGNINFFGGPSNTSVKTSAKLKQLEE    211 - 280
ENKDAMFVFLSDVWLDQVEVLEKLRIMFAGYSPAPPTCFILCGNFSSAPYGKNQVQALKDSLKTLADIIC    281 - 350
EYPDIHQSSRFVFVPGPEDPGFGSILPRPPLAESITNEFRQRVPFSVFTTNPCRIQYCTQEITVFREDLV    351 - 420
NKMCRNCVRFPSSNLAIPNHFVKTILSQGHLTPLPLYVCPVYWAYDYALRVYPVPDLLVIADKYDPFTTT    421 - 490
NTECLCINPGSFPRSGFSFKVFYPSNKTVEDSKLQGF                                     491 - 527
//

Text Mined References (20)

PMID Year Title
25924900 2015 DNA Polymerases as targets for gene therapy of hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
20065316 Mutations/polymorphisms in the 55 kDa subunit of DNA polymerase epsilon in human colorectal cancer.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
18676977 2008 The solution structure of the amino-terminal domain of human DNA polymerase epsilon subunit B is homologous to C-domains of AAA+ proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
More...