Property Summary

NCBI Gene PubMed Count 79
PubMed Score 29.31
PubTator Score 131.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 3.500 6.3e-04
interstitial cystitis 2.100 2.1e-02
nasopharyngeal carcinoma -1.400 1.1e-03
osteosarcoma -4.626 7.6e-08
primary Sjogren syndrome 1.600 1.0e-03
psoriasis 1.100 2.1e-03
tuberculosis 2.500 7.8e-05
ulcerative colitis 1.700 3.4e-02
Waldenstrons macroglobulinemia -1.632 4.7e-02

Gene RIF (59)

AA Sequence

MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPS      1 - 70
LLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD                               71 - 114
//

Text Mined References (81)

PMID Year Title