Property Summary

NCBI Gene PubMed Count 74
Grant Count 105
R01 Count 49
Funding $13,039,192.77
PubMed Score 27.72
PubTator Score 131.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia -2.204 0.012
cutaneous lupus erythematosus 3.500 0.001
psoriasis 3.300 0.000
osteosarcoma -4.626 0.000
tuberculosis and treatment for 3 months 2.900 0.000
interstitial cystitis 2.100 0.021
primary Sjogren syndrome 1.600 0.001
nasopharyngeal carcinoma -1.800 0.000
ulcerative colitis 1.700 0.034

Synonym

Accession P56279 Q6IBK7
Symbols TCL1

Gene

PDB

1JSG  

Gene RIF (57)

PMID Text
26493619 We investigated TCL1 expression at the protein level in the bone marrow of a series of 59 patients with Waldenstrom macroglobulinemia: 76% of patients expressed TCL1, which appeared to be associated with a pejorative prognostic impact.
26299617 Our results suggest that intratumoral TCL1A+ B cells are important for controlling cervical cancer development.
26090867 Suggest miR-181b as therapeutic target for chronic lymphocytic leukemia in the Emicro-TCL1 mouse model.
25936528 High TCL1A expression is associated with chronic lymphocytic leukemia.
25688912 Our study suggests that TCL1 expression profile may have a role in the prediction of overall outcome in patient with MCL and call for prospective studies.
25646413 demonstrated that miR-3676 targets three consecutive 28-bp repeats within 3'UTR of TCL1 and showed that miR-3676 is a powerful inhibitor of TCL1
25481307 Polymorphic genetic variations of cytochrome P450 19A1 and T-cell leukemia 1A genes in the Tamil population
25348018 Peptide-based TCL1-interphase mimics were potent in steric AKT antagonization.
25310835 Report frequent TCL1A rearrangements in T-cell prolymphocytic leukemia with cutaneous involvement.
24966976 Case Report: T-cell lymphoblastic leukemia/lymphoma with t(7;14)(p15;q32) [TCRgamma-TCL1A translocation] confirmed by FISH.
More...

AA Sequence

MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPS      1 - 70
LLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD                               71 - 114
//

Text Mined References (76)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26493619 2016 TCL1 expression patterns in Waldenström macroglobulinemia.
26299617 2015 Whole-transcriptome analysis of flow-sorted cervical cancer samples reveals that B cell expressed TCL1A is correlated with improved survival.
26090867 2015 miR-181b as a therapeutic agent for chronic lymphocytic leukemia in the Eµ-TCL1 mouse model.
25936528 2015 The regulatory interaction of EVI1 with the TCL1A oncogene impacts cell survival and clinical outcome in CLL.
25688912 2015 TCL1 expression predicts overall survival in patients with mantle cell lymphoma.
25646413 2015 TCL1 targeting miR-3676 is codeleted with tumor protein p53 in chronic lymphocytic leukemia.
25481307 2015 Polymorphic genetic variations of cytochrome P450 19A1 and T-cell leukemia 1A genes in the Tamil population.
25416956 2014 A proteome-scale map of the human interactome network.
25348018 2014 AKT-pathway inhibition in chronic lymphocytic leukemia reveals response relationships defined by TCL1.
More...