Property Summary

NCBI Gene PubMed Count 20
Grant Count 8
R01 Count 3
Funding $455,666
PubMed Score 7.68
PubTator Score 33.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.250 0.002

Gene RIF (3)

PMID Text
25472883 HIV-1 Tat specifically associates with MTCP1 promoter to upregulate MTCP1 expression in T cells
19064571 Observational study of gene-disease association. (HuGE Navigator)
17136114 Transgenic mice overexpressing MTCP1 develop leukemias with a CD8 central memory phenotype in most cases.

AA Sequence

MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQ      1 - 70
LYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD                                      71 - 107
//

Text Mined References (21)

PMID Year Title
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17136114 2007 The MTCP1 oncogene modifies T-cell homeostasis before leukemogenesis in transgenic mice.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707444 2002 Differential regulation of Akt kinase isoforms by the members of the TCL1 oncogene family.
11076863 2000 DNA cloning using in vitro site-specific recombination.
More...