Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.68
PubTator Score 33.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.0e-03
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.250 2.0e-03

Gene RIF (3)

AA Sequence

MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQ      1 - 70
LYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD                                      71 - 107
//

Text Mined References (21)

PMID Year Title