Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.68
PubTator Score 33.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 0.0019832099386259
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.250 0.002

Synonym

Accession P56278 Q5HYP2 p13MTCP1
Symbols p8MTCP1
P13MTCP1

Gene

PDB

1A1X   1QTT   1QTU  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG

Gene RIF (3)

PMID Text
25472883 HIV-1 Tat specifically associates with MTCP1 promoter to upregulate MTCP1 expression in T cells
19064571 Observational study of gene-disease association. (HuGE Navigator)
17136114 Transgenic mice overexpressing MTCP1 develop leukemias with a CD8 central memory phenotype in most cases.

AA Sequence

MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQ      1 - 70
LYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD                                      71 - 107
//

Text Mined References (21)

PMID Year Title
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17136114 2007 The MTCP1 oncogene modifies T-cell homeostasis before leukemogenesis in transgenic mice.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707444 2002 Differential regulation of Akt kinase isoforms by the members of the TCL1 oncogene family.
11076863 2000 DNA cloning using in vitro site-specific recombination.
More...