Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.05
PubTator Score 22.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Thoracic aortic aneurysm 15 3.348 1.7
Moyamoya disease 10 3.027 1.5

Expression

Synonym

Accession P56277 Q5HYP9
Symbols p8
C6.1B
MTCP1
MTCP1B
MTCP1NB
p8MTCP1

Gene

PDB

1EI0   1HP8   2HP8  

  Ortholog (1)

Species Source Disease
Cow OMA Inparanoid

AA Sequence

MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK        1 - 68
//

Text Mined References (15)

PMID Year Title