Property Summary

NCBI Gene PubMed Count 14
PubMed Score 21.70
PubTator Score 11.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.300 6.4e-04
astrocytic glioma -1.900 6.9e-03
Astrocytoma, Pilocytic -1.700 9.4e-05
atypical teratoid / rhabdoid tumor -2.700 4.6e-08
ependymoma -2.200 8.4e-03
glioblastoma -1.700 2.2e-06
hereditary spastic paraplegia -1.419 7.9e-03
medulloblastoma -1.300 6.7e-04
medulloblastoma, large-cell -2.800 7.5e-05
Multiple myeloma 2.121 3.6e-03
oligodendroglioma -1.400 1.6e-02
osteosarcoma 1.240 7.5e-03
ovarian cancer -1.400 1.6e-03
Parkinson's disease -1.400 1.9e-02
Pick disease -1.300 5.2e-04
primitive neuroectodermal tumor -2.000 2.8e-04
psoriasis 1.900 1.9e-04
tuberculosis -1.100 1.2e-07

Gene RIF (5)

AA Sequence

MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKA      1 - 70
KMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG                                 71 - 112
//

Text Mined References (23)

PMID Year Title