Property Summary

NCBI Gene PubMed Count 13
Grant Count 12
Funding $1,929,249.44
PubMed Score 19.96
PubTator Score 11.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Multiple myeloma 2.121 0.004
astrocytoma -3.300 0.000
ependymoma -2.200 0.008
oligodendroglioma -1.700 0.000
psoriasis 1.900 0.000
glioblastoma -2.800 0.000
osteosarcoma 1.240 0.007
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -2.000 0.000
hereditary spastic paraplegia -1.419 0.008
tuberculosis -1.100 0.000
Parkinson's disease -1.400 0.019
adult high grade glioma -2.300 0.001
pilocytic astrocytoma -1.800 0.000
Pick disease -1.300 0.001
ovarian cancer 1.800 0.003

Gene RIF (4)

PMID Text
25736597 Data show that micrRNA miR-320a directly targets cAMP-regulated phosphoprotein 19 (ARPP-19) and estrogen-related receptor gamma protein (ERRgamma) in breast cancer cell lines.
25547487 ARPP-19 may play a role in HCC pathogenesis through regulating cell proliferation.
21509594 ARPP19 gene expression is decreased in follicular variant of papillary thyroid carcinoma.
11771749 Decreased levels of ARPP-19 and PKA in brains of Down syndrome and Alzheimer's disease.

AA Sequence

MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKA      1 - 70
KMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG                                 71 - 112
//

Text Mined References (22)

PMID Year Title
25736597 2015 MicroRNA-320a sensitizes tamoxifen-resistant breast cancer cells to tamoxifen by targeting ARPP-19 and ERR?.
25547487 2014 Increased ARPP-19 expression is associated with hepatocellular carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21164014 2010 The substrate of Greatwall kinase, Arpp19, controls mitosis by inhibiting protein phosphatase 2A.
20218812 2010 miR-451 enhances erythroid differentiation in K562 cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...