Property Summary

NCBI Gene PubMed Count 117
Grant Count 33
R01 Count 28
Funding $2,554,883.38
PubMed Score 81.72
PubTator Score 126.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (57)

PMID Text
26096932 MYC is a key regulating factor for the control of ITGA1 expression in colorectal cancer.
25672754 Data indicate that CD49a(+) NK cells retain their phenotype after expansion in long-term in vitro cultures.
25550552 Integrin alpha1 and beta4 are downregulated, following Dendrofalconerol A treatment, in H460 cells.
24187131 small angle x-ray scattering data suggest that at low collagen peptide concentrations the complex exists in equilibrium between a 1:1 and 2:1 alpha1I-peptide complex.
24164540 CD49a promoted Con A-induced hepatitis through enhancing inflammatory cytokine production (IFN-gamma and IL-17A) by CD4(+) T and invariant natural killer T cells.
24124332 ITGA1 gene SNPs rs1862610, rs24321 43, and rs2447867 and the ITGA1 haplotype block that includes SNPs rs1862610 and rs2432143 were significantly associated with gastric cancer.
24018042 miR-101:DNMT-3B interaction modulates integrin alpha-1 epigenetically.
23819010 17-beta-estradiol modulates connexins and integrins as well as ER-beta expression induced by high frequency electromagnetic fields.
23448258 Pro-inflammatory cytokine tumor necrosis factor (TNF)-alpha strongly promotes pericyte proliferation and migration, and concomitantly induces a switch in pericyte integrins, from alpha1 to alpha2 integrin.
23284937 Discoidin domain receptors promote alpha1beta1- and alpha2beta1-integrin mediated cell adhesion to collagen by enhancing integrin activation.
More...

AA Sequence

MAPRPRARPGVAVACCWLLTVVLRCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGKWVLIGSPLVG      1 - 70
QPKNRTGDVYKCPVGRGESLPCVKLDLPVNTSIPNVTEVKENMTFGSTLVTNPNGGFLACGPLYAYRCGH     71 - 140
LHYTTGICSDVSPTFQVVNSIAPVQECSTQLDIVIVLDGSNSIYPWDSVTAFLNDLLERMDIGPKQTQVG    141 - 210
IVQYGENVTHEFNLNKYSSTEEVLVAAKKIVQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVT    211 - 280
DGESHDNHRLKKVIQDCEDENIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVT    281 - 350
IVKTLGERIFALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKASQIIIPRNTT    351 - 420
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQTLSGEQIGSYF    421 - 490
GSILTTTDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQMSLEPIKQTCCSSRQHNSCTT    491 - 560
ENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHGGAVYIYHGSGKTIRKEYAQRIPSGGDGKTL    561 - 630
KFFGQSIHGEMDLNGDGLTDVTIGGLGGAALFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINA    631 - 700
TVCFDVKLKSKEDTIYEADLQYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQ    701 - 770
DSVRITLDFNLTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN    771 - 840
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVTFKILFQFNTS    841 - 910
YLMENVTIYLSATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYHISIAANETVPEVINSTEDIG    911 - 980
NEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTS    981 - 1050
TDHLKRGTILDCNTCKFATITCNLTSSDISQVNVSLILWKPTFIKSYFSSLNLTIRGELRSENASLVLSS   1051 - 1120
SNQKRELAIQISKDGLPGRVPLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK              1121 - 1179
//

Text Mined References (122)

PMID Year Title
26096932 2016 Integrin ?1?1 expression is controlled by c-MYC in colorectal cancer cells.
25808196 2015 Intensified antineoplastic effect by combining an HDAC-inhibitor, an mTOR-inhibitor and low dosed interferon alpha in prostate cancer cells.
25672754 2015 Cutting edge: identification and characterization of human intrahepatic CD49a+ NK cells.
25550552 2015 Dendrofalconerol A suppresses migrating cancer cells via EMT and integrin proteins.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24823363 2014 Citrullination of collagen II affects integrin-mediated cell adhesion in a receptor-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24187131 2013 The structure of integrin ?1I domain in complex with a collagen-mimetic peptide.
24164540 2014 CD49a promotes T-cell-mediated hepatitis by driving T helper 1 cytokine and interleukin-17 production.
More...