Property Summary

Ligand Count 28
NCBI Gene PubMed Count 44
PubMed Score 50.29
PubTator Score 121.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease 1.060 2.3e-02
breast carcinoma 2.200 8.7e-04
Chronic Lymphocytic Leukemia 1.383 3.3e-03
dermatomyositis 1.600 2.7e-03
juvenile dermatomyositis 1.293 5.0e-11
lung cancer 1.600 3.6e-04
malignant mesothelioma 1.500 9.0e-06
Multiple myeloma 1.331 1.2e-03
osteosarcoma -1.148 8.9e-03
ovarian cancer 1.300 1.6e-05
Pick disease -1.100 4.7e-06
psoriasis -1.200 8.0e-04

Gene RIF (15)

AA Sequence

MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGPEDCVVPFLTRPKVPVLQLDSGNYLFSTSAICRYFF      1 - 70
LLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRALTHIDHSLSRQNCPFLAGET     71 - 140
ESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQEPCQRAAETVLKQQGVLALRPYLQKQPQPSP    141 - 210
AEGRAVTNEPEEEELATLSEEEIAMAVTAWEKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPH    211 - 280
LGNIIGCVLSADVFARYSRLRQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHIIHADIYRWFNIS    281 - 350
FDIFGRTTTPQQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDK    351 - 420
CGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGL    421 - 490
KPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWWKNPEQVDLYQFMAKDNVPFH    491 - 560
SLVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGVGVFGDMAQDTGIPADIWRFYLLYIRPEGQD    561 - 630
SAFSWTDLLLKNNSELLNNLGNFINRAGMFVSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEKVR    631 - 700
IRDALRSILTISRHGNQYIQVNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQ    701 - 770
LQLPPPACSILLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQ    771 - 840
QIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKK              841 - 900
//

Text Mined References (51)

PMID Year Title