Property Summary

NCBI Gene PubMed Count 40
Grant Count 125
R01 Count 63
Funding $23,441,084.81
PubMed Score 48.13
PubTator Score 121.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.383 0.003
Multiple myeloma 1.331 0.001
malignant mesothelioma 1.500 0.000
psoriasis -1.200 0.001
osteosarcoma -2.249 0.000
juvenile dermatomyositis 1.293 0.000
lung cancer 1.600 0.000
active Crohn's disease 1.060 0.023
breast carcinoma 2.200 0.001
Pick disease -1.100 0.000
ovarian cancer 3.300 0.000
dermatomyositis 1.600 0.003

Synonym

Accession P56192 B3KVK7 Q14895 Q53H14 Q96A15 Q96BZ0 Q9NSE0
Symbols MRS
ILLD
CMT2U
ILFS2
METRS
MTRNS
SPG70

Gene

PANTHER Protein Class (2)

PDB

4BL7   4BVX   4BVY   2DJV  

Gene RIF (14)

PMID Text
26472928 analysis of the heterotetrameric complex structure of the glutathione transferase (GST) domains shared among the four MSC components, methionyl-tRNA synthetase (MRS), glutaminyl-prolyl-tRNA synthetase (EPRS), AIMP2 and AIMP3
25913036 identification of a founder mutation in MARS led to the molecular definition of a specific type of pulmonary alveolar proteinosis and will enable carrier screening in the affected community and possibly open new treatment opportunities.
25010285 Interaction of HIV-1 Gag with methionyl-tRNA synthetase (MARS) is identified in a series of six affinity purification/mass spectrometry screens
24354524 the association of rare MARS variant with late-onset autosomal dominant Charcot-Marie-Tooth neuropathy
24103465 The F370L and I523T mutations did not affect the association of MARS with the multisynthetase complex.
23729695 Here we present data suggesting that MARS is a very rare novel cause of late-onset CMT2.
22190034 Interaction of HIV-1 Gag with methionyl-tRNA synthetase (MARS) is identified in a series of six affinity purification/mass spectrometry screens
22106287 Data show that aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3)/p18 is released from aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3) by UV irradiation-induced stress.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGPEDCVVPFLTRPKVPVLQLDSGNYLFSTSAICRYFF      1 - 70
LLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRALTHIDHSLSRQNCPFLAGET     71 - 140
ESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQEPCQRAAETVLKQQGVLALRPYLQKQPQPSP    141 - 210
AEGRAVTNEPEEEELATLSEEEIAMAVTAWEKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPH    211 - 280
LGNIIGCVLSADVFARYSRLRQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHIIHADIYRWFNIS    281 - 350
FDIFGRTTTPQQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDK    351 - 420
CGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGL    421 - 490
KPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWWKNPEQVDLYQFMAKDNVPFH    491 - 560
SLVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGVGVFGDMAQDTGIPADIWRFYLLYIRPEGQD    561 - 630
SAFSWTDLLLKNNSELLNNLGNFINRAGMFVSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEKVR    631 - 700
IRDALRSILTISRHGNQYIQVNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQ    701 - 770
LQLPPPACSILLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQ    771 - 840
QIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKK              841 - 900
//

Text Mined References (47)

PMID Year Title
26472928 2015 Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains.
25913036 2015 Biallelic Mutations of Methionyl-tRNA Synthetase Cause a Specific Type of Pulmonary Alveolar Proteinosis Prevalent on Réunion Island.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
24354524 2014 Rare variants in methionyl- and tyrosyl-tRNA synthetase genes in late-onset autosomal dominant Charcot-Marie-Tooth neuropathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24103465 2013 Rare recessive loss-of-function methionyl-tRNA synthetase mutations presenting as a multi-organ phenotype.
23729695 2013 Exome sequencing identifies a significant variant in methionyl-tRNA synthetase (MARS) in a family with late-onset CMT2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22106287 2011 Dual role of methionyl-tRNA synthetase in the regulation of translation and tumor suppressor activity of aminoacyl-tRNA synthetase-interacting multifunctional protein-3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...