Property Summary

Ligand Count 1
NCBI Gene PubMed Count 25
PubMed Score 4.68
PubTator Score 2.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 9.0e-03
non primary Sjogren syndrome sicca 1.100 1.7e-02
osteosarcoma -1.213 2.8e-05
ovarian cancer 1.600 1.4e-05
pancreatic ductal adenocarcinoma liver m... -1.410 1.4e-02

Gene RIF (8)

AA Sequence

MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTT      1 - 70
YKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH                                     71 - 108
//

Text Mined References (32)

PMID Year Title