Property Summary

NCBI Gene PubMed Count 22
PubMed Score 4.68
PubTator Score 2.70

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 1.38808739172596E-5
osteosarcoma 7933 2.78428117471786E-5
group 3 medulloblastoma 2254 0.00899264547258345
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0143164593398486
non primary Sjogren syndrome sicca 840 0.016793009825761
Disease Target Count Z-score Confidence
Down syndrome 548 3.854 1.9


  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.213 0.000
pancreatic ductal adenocarcinoma liver m... -1.410 0.014
group 3 medulloblastoma 1.100 0.009
non primary Sjogren syndrome sicca 1.100 0.017
ovarian cancer 1.600 0.000


Accession P56181 A8K0M1 J3KNX7 Q6FGD3 Q8WU60 Q9HCR5
Symbols CI-10k


PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG

Gene RIF (6)

20877624 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
16849371 The results provide new information on the function of the region affected by the MELAS mutations 3946 and 3949 that is not obtainable from patient samples or current eukaryote models.

AA Sequence

YKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH                                     71 - 108

Text Mined References (29)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.