Property Summary

NCBI Gene PubMed Count 12
Grant Count 5
Funding $236,877
PubMed Score 108.38
PubTator Score 36.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (3)

PMID Text
26350112 TPTE sero-reactivity has moderate sensitivity.
18854154 Knockdown of transmembrane phosphatase with tensin homology (TPTE) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18074101 Gene dosage change of TPTE is associated with Robertsonian Down syndrome

AA Sequence

MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESPHTSEFKGAARVSPISESVLARLSKFEVED      1 - 70
AENVASYDSKIKKIVHSIVSSFAFGLFGVFLVLLDVTLILADLIFTDSKLYIPLEYRSISLAIALFFLMD     71 - 140
VLLRVFVERRQQYFSDLFNILDTAIIVILLLVDVVYIFFDIKLLRNIPRWTHLLRLLRLIILLRIFHLFH    141 - 210
QKRQLEKLIRRRVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYR    211 - 280
VYNLCSERAYDPKHFHNRVVRIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVC    281 - 350
AFLIASEICSTAKESLYYFGERRTDKTHSEKFQGVKTPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFI    351 - 420
IYSIPRYVRDLKIQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFYSNLPTYYD    421 - 490
NCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEKMTSSDVVAGSD             491 - 551
//

Text Mined References (14)

PMID Year Title
26350112 2015 Humoral immune responses of lung cancer patients against the Transmembrane Phosphatase with TEnsin homology (TPTE).
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
18074101 2008 Gene dosage change of TPTE and BAGE2 and breakpoint analysis in Robertsonian Down syndrome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14659893 2003 The TPTE gene family: cellular expression, subcellular localization and alternative splicing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11810268 2001 The murine orthologue of the Golgi-localized TPTE protein provides clues to the evolutionary history of the human TPTE gene family.
11279206 2001 PTEN 2, a Golgi-associated testis-specific homologue of the PTEN tumor suppressor lipid phosphatase.
More...