Property Summary

NCBI Gene PubMed Count 20
PubMed Score 27.87
PubTator Score 17.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 5.0e-03
lung cancer 1.100 1.5e-02
medulloblastoma, large-cell -1.300 1.9e-03
non-small cell lung cancer 1.188 5.5e-08
oligodendroglioma -1.300 2.1e-03
osteosarcoma -2.023 1.3e-02
posterior fossa group B ependymoma -1.200 2.4e-05

Gene RIF (13)

AA Sequence

MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ      1 - 70
TQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVS     71 - 140
ASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM                                       141 - 175
//

Text Mined References (21)

PMID Year Title