Property Summary

NCBI Gene PubMed Count 46
PubMed Score 150.93
PubTator Score 65.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 3.400 2.0e-06
non-small cell lung cancer 2.052 2.8e-11

Gene RIF (30)

AA Sequence

MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKAL      1 - 70
NPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKP     71 - 140
RTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSS    141 - 210
DPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHP    211 - 280
LALASGTLY                                                                 281 - 289
//

Text Mined References (46)

PMID Year Title