Property Summary

NCBI Gene PubMed Count 19
Grant Count 50
R01 Count 24
Funding $5,701,700.16
PubMed Score 40.19
PubTator Score 16.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -3.300 0.002
ependymoma -3.600 0.001
oligodendroglioma -2.800 0.004
glioblastoma -2.400 0.044
osteosarcoma 1.887 0.000
cystic fibrosis 2.118 0.000
atypical teratoid / rhabdoid tumor -2.200 0.039
medulloblastoma -3.300 0.010
pilocytic astrocytoma -2.700 0.001
invasive ductal carcinoma 2.000 0.044

Gene RIF (11)

PMID Text
25463899 TDT results showed an association between DLX1 and cleft lip and palate, in which the A allele was undertransmited (p=0.022).
23312518 The regulation of fate switch between cortical and striatal interneurons is dependent on Dlx1 (and Dlx2).
22984994 The study data demonstrate an association between SNP rs7888172 of the DLX1 gene and non-syndromic hypodontia in Chinese Han individuals.
21357706 These findings suggest that alterations in DLX1/2 contribute to the biological consequences of FLT3 activation.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18728693 The DLX1 and DLX2 genes lie head-to-head in 2q32; the findings support the presence of two functional polymorphisms, one in or near each of the DLX genes that increase susceptibility to, or cause, autism.
18728693 Observational study of gene-disease association. (HuGE Navigator)
18384059 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYP      1 - 70
YVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQL     71 - 140
QALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSP    141 - 210
PVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM                             211 - 255
//

Text Mined References (20)

PMID Year Title
25463899 2015 DLX1 and MMP3 contribute to oral clefts with and without positive family history of cancer.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23312518 2013 Dlx1&2-dependent expression of Zfhx1b (Sip1, Zeb2) regulates the fate switch between cortical and striatal interneurons.
22984994 2012 A case-control study of the association between tooth-development gene polymorphisms and non-syndromic hypodontia in the Chinese Han population.
21357706 2011 Up-regulation of homeodomain genes, DLX1 and DLX2, by FLT3 signaling.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18728693 2009 The DLX1and DLX2 genes and susceptibility to autism spectrum disorders.
More...