Property Summary

NCBI Gene PubMed Count 69
PubMed Score 141.37
PubTator Score 92.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 2.8e-09
Atopic dermatitis -1.300 1.5e-03
breast carcinoma 1.100 7.3e-08
colon cancer -3.100 1.2e-07
cystic fibrosis -1.453 2.9e-04
ductal carcinoma in situ -1.500 8.7e-03
interstitial cystitis -1.900 3.1e-03
intraductal papillary-mucinous adenoma (... -1.800 1.3e-05
intraductal papillary-mucinous neoplasm ... -1.300 2.5e-03
invasive ductal carcinoma -1.422 4.6e-03
lung cancer -1.800 1.2e-04
malignant mesothelioma 7.100 4.9e-10
osteosarcoma -2.363 1.8e-02
ovarian cancer -1.900 4.3e-10
pancreatic ductal adenocarcinoma liver m... -2.133 1.9e-03
posterior fossa group B ependymoma -1.100 5.6e-04
psoriasis -1.500 3.4e-03
sonic hedgehog group medulloblastoma 1.700 5.3e-03

Protein-protein Interaction (2)

Gene RIF (41)

AA Sequence

MFLATLYFALPLLDLLLSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKD      1 - 70
ECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDSPYEPVNSRLSDIFRVVPFISD     71 - 140
VFQQVEHIPKGNNCLDAAKACNLDDICKKYRSAYITPCTTSVSNDVCNRRKCHKALRQFFDKVPAKHSYG    141 - 210
MLFCSCRDIACTERRRQTIVPVCSYEEREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKE    211 - 280
NYADCLLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSD    281 - 350
VTVWQPAFPVQTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGNY    351 - 420
EKEGLGASSHITTKSMAAPPSCGLSPLLVLVVTALSTLLSLTETS                             421 - 465
//

Text Mined References (69)

PMID Year Title