Property Summary

NCBI Gene PubMed Count 65
Grant Count 41
R01 Count 28
Funding $3,446,778.92
PubMed Score 137.32
PubTator Score 92.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

PMID Text
26400951 This study demonstrate, using a knock-in mouse model in which GFRalpha1 is no longer located in lipid rafts, that the developmental functions of GDNF in the periphery require the translocation of the GDNF receptor complex into lipid rafts.
25253858 GFRalpha1 levels in neurons from autopsied AD brains are significantly decreased.
25009298 Methylation changes of GFRA1, SRF, and ZNF382 may be a potential biomarker set for prediction of gastric carcinoma metastasis.
24778213 These findings collectively demonstrate that GFRalpha1 released by nerves enhances perineural invasion through GDNF-RET signaling and that GFRalpha1 expression by cancer cells enhances but is not required for it.
24139947 In the cochlea, GFRalpha-1 was identified mainly in the cell bodies of the spiral neurons. In the organ of Corti, GFRalpha-1 was demonstrated in the Deiters' cells, Hensen cells, inner pillar cells, and weakly in inner hair cells but not in the outer hair cells.
23881409 The study shows co-localization of RET with GFRA1 and GFRA2 in myenteric ganglia of the adult human colon.
23351331 The expression of GFRalpha1 and/or GFRalpha3, especially when combined with ARTN expression, may be useful predictors of disease progression and outcome in specific subtypes of mammary carcinoma.
23333304 HIV-1 Vif downregulates the expression of GDNF family receptor alpha 1 (GFRA1) in Vif-expression T cells
22729463 Mutations in GFRA1 gene is associated with urinary tract malformations.
21133924 Post-synaptic transgenic GFRalpha1 has profound effects on the development of dopamine neurons, resulting in a 40% increase in the adult number.
More...

AA Sequence

MFLATLYFALPLLDLLLSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKD      1 - 70
ECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDSPYEPVNSRLSDIFRVVPFISD     71 - 140
VFQQVEHIPKGNNCLDAAKACNLDDICKKYRSAYITPCTTSVSNDVCNRRKCHKALRQFFDKVPAKHSYG    141 - 210
MLFCSCRDIACTERRRQTIVPVCSYEEREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKE    211 - 280
NYADCLLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSD    281 - 350
VTVWQPAFPVQTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGNY    351 - 420
EKEGLGASSHITTKSMAAPPSCGLSPLLVLVVTALSTLLSLTETS                             421 - 465
//

Text Mined References (65)

PMID Year Title
26400951 2015 Lipid Rafts Are Physiologic Membrane Microdomains Necessary for the Morphogenic and Developmental Functions of Glial Cell Line-Derived Neurotrophic Factor In Vivo.
25253858 2014 Deficiency of GDNF Receptor GFR?1 in Alzheimer's Neurons Results in Neuronal Death.
25009298 2014 Large-scale characterization of DNA methylation changes in human gastric carcinomas with and without metastasis.
24778213 2014 GFR?1 released by nerves enhances cancer cell perineural invasion through GDNF-RET signaling.
24139947 2014 Immunohistological analysis of neurturin and its receptors in human cochlea.
23881409 2013 Site-specific gene expression and localization of growth factor ligand receptors RET, GFR?1 and GFR?2 in human adult colon.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23351331 2013 Prognostic significance of the expression of GFR?1, GFR?3 and syndecan-3, proteins binding ARTEMIN, in mammary carcinoma.
22729463 2012 Traditional and targeted exome sequencing reveals common, rare and novel functional deleterious variants in RET-signaling complex in a cohort of living US patients with urinary tract malformations.
More...