Property Summary

NCBI Gene PubMed Count 25
PubMed Score 54.93
PubTator Score 2.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
osteosarcoma 7933 1.56988269853104E-5
Multiple myeloma 1328 8.85640310482271E-4
ovarian cancer 8492 9.3771627852527E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00420183068612017
Waldenstrons macroglobulinemia 765 0.0291545544847676

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.242 0.029
Multiple myeloma 1.694 0.001
osteosarcoma -1.373 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.004
ovarian cancer 1.500 0.001

Synonym

Accession P56134 C9J8H9 F8W7V3 O76079 Q6IBB3 Q96L83 Q9BTI8
Symbols ATP5JL

Gene

  Ortholog (9)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVL      1 - 70
ACYVLFSYSFSYKHLKHERLRKYH                                                   71 - 94
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18596870 Identification of marker genes for differential diagnosis of chronic fatigue syndrome.
18505769 2008 Serial analysis of the vascular endothelial transcriptome under static and shear stress conditions.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...