Property Summary

NCBI Gene PubMed Count 25
PubMed Score 63.47
PubTator Score 2.49

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.100 4.2e-03
Multiple myeloma 1.694 8.9e-04
osteosarcoma -1.373 1.6e-05
ovarian cancer 1.500 9.4e-04
Waldenstrons macroglobulinemia 1.242 2.9e-02

Gene RIF (2)

AA Sequence

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVL      1 - 70
ACYVLFSYSFSYKHLKHERLRKYH                                                   71 - 94
//

Text Mined References (29)

PMID Year Title