Property Summary

NCBI Gene PubMed Count 25
Grant Count 28
R01 Count 21
Funding $4,068,157
PubMed Score 54.93
PubTator Score 2.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.242 0.029
Multiple myeloma 1.694 0.001
osteosarcoma -1.373 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.004
ovarian cancer 1.500 0.001

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVL      1 - 70
ACYVLFSYSFSYKHLKHERLRKYH                                                   71 - 94
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18596870 Identification of marker genes for differential diagnosis of chronic fatigue syndrome.
18505769 2008 Serial analysis of the vascular endothelial transcriptome under static and shear stress conditions.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...