Property Summary

NCBI Gene PubMed Count 92
Grant Count 256
R01 Count 158
Funding $45,891,027.13
PubMed Score 598.76
PubTator Score 1135.54

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P55899 Q5HYM5 Q9HBV7 Q9NZ19 FcRn
Symbols FCRN
alpha-chain

Gene

PDB

1EXU   3M17   3M1B   4K71   4N0F   4N0U   5BXF  

Gene RIF (77)

PMID Text
26337808 Data indicate improved pharmacokinetics through enhanced neonatal Fc receptor (FcRn) interactions were apparent for a complementarity-determining region (CDR) charge-patch normalized monoclonal antibody (mAb) which was affected by non-specific clearance.
26260795 Critical Role of the Neonatal Fc Receptor (FcRn) in the Pathogenic Action of Antimitochondrial Autoantibodies Synergizing with Anti-desmoglein Autoantibodies in Pemphigus Vulgaris.
26254986 FcRn binding activity of a large set of Fc-fusion samples after thermal stress, was investigated.
26252948 analysis of binding motifs in the hFCGRT promoter that interact with their corresponding (Sp1, Sp2, Sp3, c-Fos, c-Jun, YY1, and C/EBPbeta or C/EBPdelta) transcription factors (TFs) suggests their involvement in regulation of human FCGRT gene expression
25823782 none of the three functional polymorphisms in FcgammaR genes explored here, the FCGR3A F158V and FCGR2B I232T nsSNPs and the VNTR in FCGRT, showed an association with the response to TNFi in patients with rheumatoid arthritis
25658443 The neonatal Fc receptor (FcRn) binds independently to both sites of the IgG homodimer with identical affinity.
25652137 These data indicate that human FcRn facilitates the transepithelial transport of IgE in the form of IgG anti-IgE/IgE ICs.
25344603 domain I and III of albumin required for optimal pH-dependent binding to the neonatal Fc receptor
25030041 These results suggest that hFcRn Tgm are a valuable and useful tool for pharmacokinetic screening of mAbs and Fc-fusion proteins in the preclinical stage.
24853685 The extents of IgG expression in 86 lung cancers were found to associate with clinical stage, pathological grade and lymph node metastasis.
More...

AA Sequence

MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP      1 - 70
CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF     71 - 140
MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR    141 - 210
PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA    211 - 280
GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA    281 - 350
QDADLKDVNVIPATA                                                           351 - 365
//

Text Mined References (96)

PMID Year Title
26337808 2015 The interplay of non-specific binding, target-mediated clearance and FcRn interactions on the pharmacokinetics of humanized antibodies.
26260795 2015 Critical Role of the Neonatal Fc Receptor (FcRn) in the Pathogenic Action of Antimitochondrial Autoantibodies Synergizing with Anti-desmoglein Autoantibodies in Pemphigus Vulgaris.
26254986 2015 Effect of protein aggregates on characterization of FcRn binding of Fc-fusion therapeutics.
26252948 2015 Analysis of Response Elements Involved in the Regulation of the Human Neonatal Fc Receptor Gene (FCGRT).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25823782 2015 FCGR polymorphisms in the treatment of rheumatoid arthritis with Fc-containing TNF inhibitors.
25658443 2015 The neonatal Fc receptor (FcRn) binds independently to both sites of the IgG homodimer with identical affinity.
25652137 2015 Evidence that FcRn mediates the transplacental passage of maternal IgE in the form of IgG anti-IgE/IgE immune complexes.
25344603 2014 Interaction with both domain I and III of albumin is required for optimal pH-dependent binding to the neonatal Fc receptor (FcRn).
25030041 2014 Application of human FcRn transgenic mice as a pharmacokinetic screening tool of monoclonal antibody.
More...