Property Summary

Ligand Count 32
NCBI Gene PubMed Count 103
PubMed Score 657.03
PubTator Score 1135.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.389 2.2e-02
adrenocortical carcinoma -1.623 1.1e-04
adult high grade glioma 1.500 1.7e-03
astrocytoma 1.800 1.1e-03
Astrocytoma, Pilocytic 1.900 5.9e-10
atypical teratoid / rhabdoid tumor 1.100 7.1e-05
ductal carcinoma in situ -1.100 4.5e-03
ependymoma 1.200 1.3e-08
esophageal adenocarcinoma 1.100 2.4e-02
glioblastoma 1.200 3.6e-06
lung carcinoma -1.400 7.5e-27
non-small cell lung cancer -1.245 9.5e-21
subependymal giant cell astrocytoma 1.677 4.3e-02
tuberculosis 1.300 5.0e-07
ulcerative colitis -1.800 1.2e-10

 CSPA Cell Line (3)

Gene RIF (85)

AA Sequence

MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP      1 - 70
CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF     71 - 140
MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR    141 - 210
PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA    211 - 280
GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA    281 - 350
QDADLKDVNVIPATA                                                           351 - 365
//

Text Mined References (107)

PMID Year Title