Property Summary

NCBI Gene PubMed Count 76
PubMed Score 784.18
PubTator Score 312.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
osteosarcoma 7950 2.7e-09
psoriasis 6694 3.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Melanoma 711 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.995 2.7e-09
psoriasis -1.100 3.8e-02

 GO Component (1)

Protein-protein Interaction (1)

Gene RIF (52)

AA Sequence

MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHLDVKHNHVKLKPTIFSKDSCYLP      1 - 70
PLRYPATCTFKGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKVTFRCTEKDLVGDVPEARYGH     71 - 140
SINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLPCVFLVDFEFGCATSYILPELQDGLSFHVSI    141 - 210
AKNDTIYILGGHSLANNIRPANLYRIRVDLPLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLE    211 - 280
NQKRMICNIISLEDNKIEIREMETPDWTPDIKHSKIWFGSNMGNGTVFLGIPGDNKQVVSEGFYFYMLKC    281 - 350
AEDDTNEEQTTFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFDTYNEDDEEDESETGYWITCC    351 - 420
PTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNEHVEIARALHT    421 - 490
PQRVLPLKKPPMKSLRKKGSGKILTPAKKSFLRRLFD                                     491 - 527
//

Text Mined References (77)

PMID Year Title